You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All-Inclusive Offers
- Early Booking Offers
- Europe Offers
- Indian Ocean Offers
- Maldives Offers
- Last Minute Holidays
- Luxury Holidays
- Shopping Holidays
Featured Destinations
- Switzerland
- United Kingdom
- Philippines
- South Korea
- South Africa
Australasia
- New Zealand
Indian Ocean
- Czech Republic
- Antigua and Barbuda
- All-Inclusive Holidays
- Beach Holidays
- Business Class
- City Breaks
- Family Holidays
- Romantic Retreats
- Umrah Packages
- Costa Rica Tours
- Europe Tours
- Germany - Landscapes of Germany
- Jordan Tours
- Malaysia Tours
- South Africa Tours
- Sri Lanka Tours
- Tanzania - Best of Selous and Zanzibar
- COVID-19 Hub
- Branch Location & Timings
- Pay My Balance
- Flight + Hotel
Search Holidays
- Manage My Booking
An Unforgettable Umrah
Packages to suit your pilgrimage
Umrah ā a long-awaited journey, a lifetime experience. At Emirates Holidays, we understand the importance of making your Umrah pilgrimage as special and sacred as possible, which is why weāve customized packages just for you.
From hand-picking hotels in Makkah that are within walking distance from Al Masjid Al Haram, to arranging return flights and airport transfers to and from Jeddah, weāll make sure your holy journey is as seamless and stress-free as possible.
Reach out to one of our experienced travel consultants to plan your perfect journey today.
Limited-time offer
Pullman zamzam grand suites, makkah.
- 4 nights from AED 2,949pp
- Classic Room
- Breakfast included
- Return Emirates flights from Dubai (DXB)
- Additional Skywards Miles
- All taxes and surcharges included
Valid for new bookings only and subject to availability.
Swissotel Al Maqam Makkah
- 4 nights from AED 3,039pp
Hilton Suites Makkah
- 4 nights from AED 3,429pp
- Standard Guest Room City View
Conrad Makkah
- 4 nights from AED 3,569pp
- Superior Room
Jabal Omar Hyatt Regency Makkah
- 4 nights from AED 4,079pp
- Room with King Bed/Twin Beds
Raffles Makkah Palace
- 4 nights from AED 4,299pp
- Signature Suite City View
Join the Emirates Holidays Community
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
Umrah Packages May 2024 | Umrah Package By Bus | Umrah Package By Air
Desert Dream Tourism offering cheapest Umrah Package by bus by air from Dubai & Sharjah which includes umrah visa, economy & 5 star accommodation and free shuttle transportation. We offers the best Umrah package by bus and by air . Our Affordable and low budget Umrah packages are available from dubai & sharjah .
Umrah Package By Bus From Dubai & Sharjah
Umrah package by bus with economy hotel.
(10 Days Package)
Ramadan Umrah Package By Bus From Dubai & Sharjah
Ramadan 1st ashrah umrah by bus package no.1 from sharjah & dubaiĀ , ramadan 1st ashrah umrah by bus package no.2 from sharjah & dubaiĀ , ramadan 2nd ashrah umrah by bus package from sharjah & dubai, ramadan 3rd ashrah umrah by bus package from sharjah & dubai, ramadan 3rd ashrah umrah by bus package from sharjah & dubaiĀ .
( First Madinah Package )
Note : *400 AED will be deducted from the above packages, if you already have Saudi Visa.
(Limited Time Offer)
For Booking & Details Call : +971 50 421 8331
UMRAH PACKAGE BY BUS INCLUDED
- Umrah Visa With Insurance
- Complete Sharing Transportation
- Hotel Accommodation
- Trained tour guides
- Ziayrat of holy places
- Food not included in the package.
Umrah Package By Air From Dubai & Sharjah
Vip umrah packages from sharjah, economy umrah package by air.
(5 Nights Package)
2 Nights Madinah / 3 Nights Makkah
Booking Dates Available For 5 Nights Umrah By Air Package
Ramadan umrah package by air from dubai & sharjah, ramadan by air umrah package ( 4 star hotel ), ramadan economy by air umrah packageĀ , ( economy hotel ).
Note : *400 AED will be deducted from the above packages, if you already have Saudi Visa. Customized umrah by air packages are also available on demand
UMRAH PACKAGE BY AIRĀ INCLUDED
- Saudi Visa with Insurance
- Return Air Ticket
- * Madina Airport to Madina Hotel
- * Madina Hotel to Makkah Hotel
- * Makkah Hotel to Jeddah Airport
- Historic place visit guide
- Food not included in the package
REQUIRED DOCUMENTS
- Original passport (Passport should be valid for 6 months & UAE Residence Visa Should be valid for 4 months).
- 1 Passport size photo with white background.
- Emirates ID card Copy.
- Umrah visa open for all ages
Umrah Packages From Dubai & Sharjah By Bus & By Air
Our umrah by air & umrah by bus packagesĀ are a collection of services and facilities you need to go to Umrah such as 5-star, 4-star hotel accommodation, bed sharing optionsĀ etc.Ā You can read all the details aboutĀ Umrah package with services and flights before purchasing the package. Get Umrah packages from authorized travel agents in Dubai. Our 10 Days Umrah Package By Bus & 5 Days Umrah Package By Air are very popular in dubai & sharjah. A majority of Muslims consider these packages suitable for traveling to Saudi Arabia.
Still confused about how to choose the best Umrah package? Simply call us and our umrah packages expert will design a custom package for you according to your budget and get you the best deals at affordable prices!
Tags: umrah packages 2024,umrah packages from dubai ,umrah packages from sharjah, umrah packages from ajman abudhabi, umrah packages from uae, umrah packages from emirates, umrah package from dubai , umrah package by air ,umrah package by bus, umrah visa from dubai sharjah
UMRAH PACKAGES FROM DUBAI & SHARJAH
Why we are the best.
We are UAE Based Company Operating Umrah Services in Dubai & Sharjah.
Ramadan Umrah Package By Air
Umrah Packages in Ramadan By Air 2024
Ramdan Packages
By Air Ramdan Umrah Package 2024
Every Week Flight Depart
Duration-5 Nights
2 Nights Madinah 3 Nights Makkah Stay.
NOTE: Above mentioned rates are WITHOUT VISA cost
Umrah Package by Air Includes:
- Return Air Tickets.
- Highly experienced assistance.
- Hotell Stay in Madinah Makkah.
- Airport transfers.
- Transportation inside Saudi Arabia.
- If you donāt have visa we will arrange umrah or tourist visa depending upon your profession and nationality
Documents Required
- Passport Validity 6 months.
- Residence visa validity 3 months.
- Passport size photo in white background.
- Emirates ID Copy.
Umrah Packages in Ramdan by Bus
Ramadan Umrah Package By Bus
Ramdan 2024
Ramdan Umrah Package 2024 by Bus
Every Week Bus Depart
Duration-10 Days
Ramadan Ashra Packages 2024
REMARKS: Above mentioned rates are calculated on a per person basis
Umrah Package by Bus Includes:
- Multiple entry 1 year saudi visa with insurance
- Transportation
- Hotel accomodation in Makkah and Madinah.
- Zyarat in saudia
- Assistance in Saudia.
- Food not included in the package.
Happy Client's
Our client's words.
What people are saying about US
"It was great experiance to go umrah from dubai with you"
"Umrah package dubai is a best umrah service provider in sharjah. Excellent service. Their service quality is best then other umrah agents in dubai.
"We had great exprience with you. every Muslim has a wish to go for Umrah once in his llife and alhamdulillah umrah package dubai fulfill my dream. I was so happy during umrah. Jazakallah"
Our Most Popular Packages
We have helped travelers from across the UAE to fulfill their promise to Allah.
Umrah Packages By Bus
Umrah Packages By Air
Ramadan Umrah Packages
Document requirements.
Document Requirments for umrah visa from Dubai
How to Perform Umrah
Complete step by step umrah guide video
Approved COVID Vaccines For Umrah
Saudi Ministry Veccine Requirements from Dubai.
Online Booking
Book umrah pcakge online from anywhere in uae
New Umrah Visa Rules from Dubai
Here are some question or answer for umrah visa
Designed Expertise of Umrah Packages
Welcome to umrahpackagedubai.com the old and well known Umrah Agency in Dubai Operating Since Decades. The aim of our travel and tourism Umrah agency is to provide the best level of VIP standards hospitality.
Our main goal is to serve each and every pilgrim to have a comfortable, secure and trouble-free journey to perform Umrah from Dubai, Sharjah. Hajj and Umrah is a form of worship with which there is a religious connection, with which Muslims also have a religious connection. And every person wants to go to Mecca and Medina once in his life and perform Umrah. With Kindness, commitment, resources and professional skills, we provide travel and tourism solutions that permit pilgrims to enjoy their umrah experience without any strain about arrangements. Pay full attention on Umrah Worships and get reward from Allah AZUL.
We offer hundred percent quality and satisfied Several Umrah Packages / services to perform umrah from umrahpackagedubai.com. We provide conveyance to alone and group pilgrims with a suitable budget. We have special Umrah Packages Like Umrah by Luxury Bus or Umrah by Air both convinces and flight departing according to schedule from Dubai, Sharjah and in all UAE. We have a large number of expert schemes with affordable and customised Umrah Packages for pilgrims Like 2-star, 3-star, 4-star economy, Golden, silver and customise.
We also provide Family Package for Umrah from Dubai, Sharjah and in all UAE We will arrange an Umrah visa and you can go for Umrah in your own Car. We can also arrange urgent Umrah Visa service within a few days that we are here to help you out and provide solutions or solve all complications that may arise during the approval of urgent visa. We have thousands of satisfied clients for our services. All of that significantly prior to our website page umrahpackagedubai.com as we always endeavour that our customers never be disappointed to make a deal with us.
Please wait.
loading requests...
Welocome login in to your accont, register for your account.
Want to book an Umrah package from Dubai?
Whether you are planning to perform Umrah in this year or in the future, you are in the right place. We are very proud that we have provided Umrah services since the last decade. As a result of this website, thousands of Muslims have been able to perform Umrah. Our travel agents provide information on Umrah visas and various Umrah packages. These Umrah packages are within your budget while providing good quality and standard. Our Umrah package from Dubai includes excellent transport arrangements for all Muslim pilgrims wishing to perform Umrah in Dubai. The Umrah package by air and the Umrah package by bus are also being provided here with updated service and complete guidance from experienced travel agents.
Types of Umrah Packages
Domuments requirement for umrah visa.
- A clear copy of your passport (the passport should be valid for 6 months and the visa should be valid for 3 months).
- 1 Passport size photo with white background.
- National ID card Copy (Front and Back).
- NOC Letter in English or Arabic from the company / Sponsor.
- Processing Time (Approx. 2-3 working Days).
1. Ramadan Umrah Package Prices
2. normal umrah package prices.
Note: These prices below are not applicable during the Ramadan period.
Umrah Package by Bus Prices
Umrah package by air prices, world wide umrah services.
We offer competitive pricing and best customer support available 24/7 over Whatsapp. Our travel agency received five star ratings across the globe for umrah services.
- Visa Services - It only takes 2 steps to apply for an umrah visa online. Submit the documents and make the payment online.
- Flights Reservations - We always have the best prices for Umrah flights when you book with SouthTravels.
- Hotel Booking - Since we collaborate with top hotels in Saudi Arabia, we offer luxury hotels at the best prices.
- Transportation - VIP transportation services are available from Makkah to Madina and vice versa through our agency.
FAQ about Umrah Packages
You can come directly to our SouthTravels office and make the payment, or one of our agents will send a payment link to your WhatsApp or email ID, and you can pay online. You will receive a payment confirmation receipt once your payment is complete. Our agent will send all details via WhatsApp or email.
No, but there are some special conditions. If your family members are visiting Dubai on a Visit Visa, they can perform Umrah from the UAE. If you need help performing umrah with a visa and a complete umrah package, we can arrange it for you.
You must hold a valid passport with a validity of at least 6 months, and your visa must be valid for at least 3 months.
Yes, If you have a valid ticket, you can go to your country.
To get an Umrah visa, it takes a minimum of 5 to 7 working days after submitting the necessary documents.
APPLICATION FORM
Please wait, while we are processing your requests.
5 Star VIP Umrah Packages from Dubai by Air
5 star vip umrah packages from dubai.
Those looking to enjoy their experience at the holy sites in the most comfortable manner will appreciate our 5-star Umrah packages. Keeping their needs in mind, we have designed 5-star Umrah packages. With our 5 Star Umrah package, you’ll stay at 4 and 5 star hotels in Makkah and Madina. In addition to breakfast, room service, WiFi, and air conditioning, pilgrims can enjoy the hotel’s amenities during their stay. In most cases, the hotels in Makkah and Madina that are offered as part of a five-star Umrah package are the closest to Masjid Al-Haram and Masjid Nabawi.
- 5 days Makkah ” Swissotel (B & B) “
- 5 days Madinah ” Shaza Al Madinah (B & B) “
- * Visa & Transportation are included
- * Flight tickets are included
- Ā Ziyarat visits included
- * Package price is based on 4 people sharing
- Note: Mentioned prices are only for low season.
Tour Reviews
There are no reviews yet.
Leave a Review
Cancel reply.
Save my name, email, and website in this browser for the next time I comment.
You May Also Like
Umrah Visa from Dubai, Sharjah & Abu Dhabi & Ajman
Cheapest Umrah Package from Dubai By Bus
3 Star Economy Budget By Air Package
Please keep changing, contact us for the latest price. Dismiss
- +971504173057
- [email protected]
Best Umrah Packages From Dubai & Sharjah
We value our clients and take pride in serving them in the most proper way and keep them updated about the new packages & services. With our own network of hotels & transport in Saudi Arabia along with our team of experts having vast experience in providingĀ Umrah Services and with over 20 years of experience in aviation. We make it our priority to ensure a comfortable Hajj and Umrah experience.
Ramadan Umrah Package By Air From Dubai & Sharjah
Ramadan Umrah By Air Packages
(5 Nights Ā Package )
3 Nights Makkah / 2 Nights Madinah
Ramadan Economy Air Package
Ramadan 4*Air Package
Ramadan last ashra 4* packageĀ , umrah package by air included :, required documents :, ramadan umrah package by bus from dubai & sharjah.
Ramadan Umrah By bus Packages
(10 Days Ā Package )
6 Nights Makkah / 2 Nights Madinah
1st Ashra Package
1st ashra package 2, 2nd ashra package, last ashra package, ramadan bus packages madinah first then makkah, 27 march packageĀ , 24 ramadan package, umrah package by bus included :, umrah package by air from dubai & sharjah.
Ā Umrah By Air Packages
Economy package, 4* air package, 5*air package, umrah package by bus from dubai & sharjah.
Umrah Package By Bus
(10 Days Duration)
5 Nights Makkah / 3 Madina Madinah (Bus Depart Every Wednesday)
Umrah Package With Economy Hotel & Free Transportation
Umrah Package Bus Schedule
For more details or request custom package call: +971 50 417 3057
Umrah Musafir is committed to provide best umrah packages
WeĀ believe in reliability, quality customer service , and the willingness and dedication to serving you the best umrah packages
Satisfied Pilgrims
Umrah tours, satisfaction level.
Our customers are very happy with our services.
You can learn more from our asked questions
Have custom travel requirements write to us, contact our support team for your umrah umrah travel.
Get A Costom PackageĀ
Especially Designed For You
Contact us and avail different type of umrah packages offered from Dubai & Sharjah. Our umrah agency make it convenient for you to visit the Holy Kabba without any hustle.
Get a Umrah quote – Find the perfect umrah packages by bus as per your family needs or for yourself,Ā
Call: +971 50 417 3057
- [email protected]
Umrah Packages From Dubai
Avail great offers for Umrah packages from Dubai for the month of September, October, November and December. Saifco Travel & Tourism offer VIP Packages in afforadable prices with all other things included as part of our deal.
We offer various packages / Services to perform Umrah from Dubai according to the convenience and budget of the pilgrims either traveling alone or in groups. We have special packages like Umrah by Luxury Bus and Umrah by Air both from Sharjah / Dubai / Abu Dhabi departing every Wednesday.
Umrah Offered By
We believe in reliability, quality customer service, and the willingness and dedication to serving you the best umrah packages from Dubai. Now you can avail different travel options for Umrah journey.
Umrah By Bus
Dubai to umrah packages by bus with luxury and VIP transport options. All bus packages include umrah visa and travel insurance.
Umrah By Air
Book best deals for umrah packages from Dubai by air and avail great discounts. All packages includes esaudi visa.
Umrah Packages
5 nights 5 star umrah package 2023, 3 nights in makkah, 2 nights in madinah, 5 nights 4 star umrah package 2023, 5 nights 3 star umrah package 2023, 7 nights 3 star umrah package 2023, 4 nights in makkah, 3 nights in madinah, saudi tourist visa (one-year multiple entry visa).
Saudi Arabia has opened its doors to visitors from all over the world with its evisa program since September 2019. Visitors can get a multiple-entry visa valid for one year. It will allow them to stay in the country for up to 90 days at once. The visa is relevant to tourism-related activities and Umrah (excluding Hajj season) and excludes other activities such as studying.
read details
Domuments Requirement for Umrah Visa
- Clear Scans of Passport Copy ( Passport should be valid for 6 months & Visa Should be valid for 3 months) .
- 1 Passport size photo with white background.
- National ID card Copy ( Front and Back).
- NOC Letter in English or Arabic from the company / Sponsor.
- Processing Time ( Approx. 2-3 working Days ).
World Wide Umrah Services
Our travel agency got 5-star ratings globally for Umrah services. We offer competitive pricing with best customer support available 24/7 over WhatsApp.
Visa Services
Avail Umrah visa with just a 3 step online process and get approval in 48 hours.
Flights Reservations
Booking flights is easy with Saifco Travel; we always have the best prices for Umrah flights.
Hotel Booking
Book luxury hotels at the best prices, as we are in collaboration with top hotels in Saudi Arabia.
Transportation
Our agency offers different VIP transportation facility from Makkah to Madina and vise versa
How to perform Umrah
Happy clientās, umrah testimonials.
I got my multi-entry visa invitation for Saudia Arabia from Saifco. They arranged it within one day. I am very happy with their fast and reliable service. The price was reasonable too compared to other companies. The staff was very professional and Cooperative. He answered all my questions patiently.
Azeem Sarwar
I contacted saifco travel for an umrah visa for me and my wife. They arranged the visa within two days. Everything was hassle-free. They helped in booking my airline ticket and hotel booking. They also arranged private transport for me at a reasonable price. highly recommend.
Muhammad Ali
WEBSITE DEVELOPER
Good prices with excellent service. Irfan Ullah is very helpful and cooperative for Umrah pilgrims. The hotel accommodation was near and very clean. I am really happy with the services. Iāll recommend to the people to do Umrah with Saifco Travel. 5/5
Abdul Kareem
BUSINESS MAN
I booked Umrah package in the last Ashra of Ramadan with Saifco Travel and tourism and i am glad to say that I am satisfied with the company’s services and it was up to my expectation. I highly recommend saifco to everybody going for umrah from Dubai. Use saifco services for your Umrah trip.
Furqan Hussain
Best Company for Umrah. I get my Umrah visa in 2 days. I am really satisfied with the prompt services. Irfan arranged whole things very properly.
AUDITIOR, JFZ
Got very satisfactory service from Mr.Irfan while booking my Umrah package from Saifco Travel and Tourism. Everything turned out just as promised.No issues with the hotels or travel arrangements. Irfan worked very hard and patiently to meet our demands.
My family’s Umrah visa was issued through this company within two days, the service was very quick. they booked our hotels in Makkah close to Haram . The trip was perfect and spiritual.
Saifco Travel is one of the best Companies for Umrah packages in Dubai, they provide very good services, Iām extremely satisfied with their arrangement. Highly recommended
Hira Saleem
MANAGING DIRECTOR, MZ TRADING
Very good service from start to end.i Really recommend this company and will definitely use their services for Umrah in future. Hotels were great and affordable.Flights were on time. Reasonable pricing and great service from the guys in the office.Over all everything went hessale free.
EMIRATES AIRLINE
My Umrah trip was memorable, I wish to go to Makkah again, very peaceful, a different kind of feelings there.
Mehmood Madni
Umrah Packages UAE
Find the perfect Umrah package by bus as per your family’s needs or for yourself. We’ve got a wide range of luxury, VIP, 5 Star, 4 Star, and 3 Star packages to perform Umrah by bus and air from all emirates in the UAE .
Umrah from Dubai
Saifco Travel is a UAE-based specialist Umrah Travel Agency providing luxury Umrah packages by Bus and Air.
Umrah from Abu Dhabi
Avail Cheap Umrah by bus and air packages from Sharjah. Visa services are included in all of the packages.
Umrah from Sharjah
Our experienced and highest quality services range from just Umrah Visa to a complete Umrah package
Umrah for Single Ladies
Yes, We make this possible for all single ladies to perform umrah without mahram. Contact us and avail different type of umrah packages offered from UAE and UK . Our umrah agency make it convenient for single ladies to visit the Holy Kabba without any hustle.
A UAE Visit visa holder can perform Umrah.
No, but there are some special conditions. If your family or parents are coming to Dubai on a visit visa, they can go for Umrah from the UAE. If they bring an Umrah visa from their country.
Can I still travel if my passport is expiring soon?
Your Visa must be valid for at least 3 months, and your passport must be valid for 6 months.
Can I travel in my own Car?
Going to Mecca from Dubai in your own car. This service is not available right now for UAE residents.
Can I go to my country from Saudi Arabia after performing Umrah?
Yes, you can go to your country if you have a valid air ticket.
How long does it take to process a visa application?
After document submission, it takes a minimum of 5 to 7 working days to get an Umrah visa.
Umrah Packages from Dubai
Imagine getting one of the best Umrah packages from Dubai for a seamless tour to Makkah and Madina. Let Saifco Travel & Tourism make your imagination come true as we have already done for many of our customers. Every Muslim wants to visit Makkah and Madina for Umrah or Hajj. Since Hajj is getting quite expensive these days, Umrah looks like the only feasible option. And it becomes even more affordable when you get Dubai to Umrah packages from us. We are all about facilitating our customers and we deeply care about you. Since our main aim is to satisfy all of our customers, you canāt expect anything less from us. Everything will be top class whether it is hotel arrangements or flight booking. 5-star hotels are waiting for you. On top of that, you travel in luxurious buses with air-conditioning and comfy seats. They have headrests and hand rests so that you donāt feel much tired on the long journey.
You can plan the whole Umrah tour with us and there will be no deviations from that schedule. By getting an Umrah package from Dubai 2023 from us, you make sure that you can travel with ease. You get all the luxuries and facilities that you are hoping for.
Umrah Inquiry: +971 55 633 7710
Umrah and Its Importance
Umrah is a āminor pilgrimageā, unlike Hajj which is the major one. Although itās obligatory, Umrah is a sunnah and carries great reward in Islam. Muslims who have the adequate resources and health to perform Umrah should do so multiple times in their lives. Thatās why we are trying to make it affordable for everyone by offering our Umrah service in Dubai. Umrah also erases the past sins of the person who performs it with the pure intention of gaining Allah Almightyās mercy. It purifies the mind and soul and reduces the negativity in your thoughts. This āminor pilgrimageā will uplift you spiritually as well as mentally.
To attain closeness to Allah Almighty, Umrah is one of the best deeds someone could perform. It teaches us about the hardships and difficulties in life. We have to put in extra effort to come closer to Allah Almighty by sacrificing our sleep, time, and money. Seeing the Holy Kaabah right in front of you might make you cry out of joy. Itās nothing to what you see on TV. The Holy Kaabah looks more magnificent when you see it up close.
After knowing about all these benefits, would you also like to perform Umrah with convenience? We make it possible for everyone to go on this āspiritual tourā to Makkah and Madina. Here you will not only enjoy your time but also get a chance to come closer to Allah Almighty. We will provide you with affordable Umrah Packages from Dubai.
Umrah for Single Ladies Is Now Possible
Thereās also good news for single ladies or females of any age. They can now travel without a mahram for Umrah which means they can get Umrah packages from Dubai easily. Single women have always had difficulties while applying for Umrah or while going to visit the holy place. Well, with us they can plan their whole journey by getting a visa and ticket and booking their hotels and transportation. Single ladies can travel in groups as well which makes them feel even more comfortable. They can converse with other women and make new friends along the way. Overall, their journey will be fantastic and easy if they choose us as their travel agency. We will also make sure that they feel completely safe while traveling with us. And if they want to get an Umrah visa from us without paying for transportation and hotel charges, thatās also possible. In this way, they can book hotels of their choice if they want. If you are a single lady, talk to us and plan your next Umrah tour with ease.
Umrah Visa Services
When you opt for our Umrah Service Dubai , you can do Umrah by getting just a visa from us. This means you donāt have to pay for flight or bus tickets. And you have to book hotels in Makkah and Madina on your own. We are all about providing convenience to our customers and thatās why we offer an ā Umrah with visa onlyā option. In this way, you can make your arrangements for hotels and transportation. But getting the full Umrah package from us is cheaper than getting only a visa. Thatās because we know all the good hotels in Saudi Arabia and we can help you by booking those at a lower rate. We have connections in this industry due to our several years of experience in this domain. So, we can also arrange transportation for you at a lower price.
Umrah Visa Requirements From UAE
We have compiled a checklist to help you perform Umrah without inconvenience. Make sure to follow this checklist for Dubai to Umrah packages to save yourself from any kind of trouble.
ā Clear scans of UAE visa & passport (the validity of the visa should be three months and of the passport six months)
ā Clear scans of both sides of the Emirates ID card
ā Passport-size photo with white background
ā NOC Letter from the sponsor / Company in Arabic or English language.
ā Covid vaccines that are accepted: Two doses of (AstraZeneca / Moderna / Pfizer) or Two doses of Sinopharm + One Booster dose of (AstraZeneca / Moderna / Pfizer)
ā Covid Vaccination Card / Certificate (acceptable of any country)
The processing time is approximately 2-3 working days so please donāt expect anything before that. We try our best to provide you with everything on time including the visa, ticket, and accommodation. So, you donāt need to worry as you can easily get an affordable Umrah package from Dubai 2023. Plan your tour with us and we will make sure you come back to us for more tours.
Umrah Package from Dubai by Air
If you want to choose a fast mode of transportation, you can get an Umrah package from Dubai by air. The flight from Dubai to Saudi Arabia usually takes less than 3 hours. There are different packages for flights. You can choose to sit in the economy class or opt for the premium package. Whatās more, you can even select the dates of your departure and arrival. We understand that everyone is busy and needs personalization for flight dates. So we make sure to cater to every kind of request our customers make. This means you will be more than happy to choose us as an Umrah service in Dubai. After your visa is approved, we will arrange transportation and hotels for you. The package contains a visa, ticket, and hotel booking. For further information on rates, you can go to this link: https://www.mysaifco.com/umrah-by-air-from-dubai/
Umrah Package from Dubai by Bus
By getting an Umrah package from Dubai by bus , you can travel in a luxurious bus. The buses are air-conditioned so you wonāt be bothered by the hot weather of Saudi Arabia and Dubai. The whole journey time is usually 18 to 24 hours but you wonāt feel much tired as the buses are comfortable. However, if you want to reach earlier, you can choose to get an Umrah package from Dubai by air. Please view the bus schedule here:
Our package for Umrah by bus comprises of luxury bus service from Dubai to Makkah or Madina and then back to Dubai. We depart every Wednesday, so even if you canāt travel for now you can book for the next week. You pray the first Juma prayer at Masjid al-Haram Makkah. And you pray the 2nd Juma prayer at Masjid e-Nabawi Madina. The total package includes a 5-night stay in Makkah and a 3-night stay in Madina. You can also customize a package according to your preference to stay for more days and nights.
Food is not included in our Umrah packages from Dubai. Booking is closed 5 days before departure. For booking, kindly submit full payment in advance along with a passport copy. Keep in mind that the whole tour lasts for 10 days. We provide you with the option of sharing 5, 4, 3, or 2 beds. The sharing of 5 beds is the cheapest option. But if you want to go for a less crowded room, you should opt for sharing of 2 beds.
A 3-star hotel is what you will get in this Umrah package from Dubai 2023. The distance of your hotel is about 800 meters from Al-Masjid an-Nabawi Madina and 950 meters from Masjid al-Haram Makkah. For guidance, an experienced scholar will be there for the group in this Umrah package from Dubai by bus.
Customized Dubai to Umrah Packages
What do we mean when we say you get an option to customize Umrah packages from Dubai? We mean that you can choose your flight dates, hotels, and transportation. By picking your flight dates, you donāt have to worry about being unable to reach back to work on time. Everything is on time and you fully enjoy the tour. As for the hotels, you can choose from a 3, 4, or 5-star hotel. For a more luxurious experience, you should opt for 5-star hotels. But for an economical Umrah package from Dubai 2023, you can go for the 3-star hotels. Try to book a hotel near Masjid-e-Haram Makkah and Masjid-e-Nabawi Madina. This will help you to reach for prayers on time which is the main purpose of going for Umrah. If you book a hotel that is far from the mosques, you will need public transport to cover the distance. There is always the option of walking as well if you are looking for some exercise.
In our Dubai to Umrah Packages, almost all the hotels have spacious rooms. You can easily move around them and place your luggage. Overall the whole room is clean and hot water is available in the bathroom. The instant heating system inside the washrooms is amazing. It instantly heats water so that you can bathe quickly. There are neat and clean cupboards and the bedsheets are also washed. In a large number of hotels, thereās air conditioning to cool the hot rooms for your comfort. Since itās mostly hot in Saudi Arabia, ACs are a blessing. For the cold weather, there might be heaters in some hotels as well.
You have two ways of reaching Makkah and Madina when you get our Umrah service in Dubai. You can either go to Umrah by air or by luxury bus. Both options provide their way of convenience. Traveling by air consumes less time but going by bus might be more enjoyable, especially with friends or family. In this way, you can spend more quality time with your loved ones.
Vaccination for Getting Umrah Service Dubai
Itās quite important to get vaccinated both in terms of being safe and keeping others safe as well. After all, you canāt get Dubai to Umrah packages without being vaccinated. We mean you can get the umrah packages but you wonāt be able to travel. Thatās the requirement set by the officials in Saudi Arabia for performing Umrah. Since Covid is showing no signs of stopping, itās vital to be vaccinated to stop the spread further. And if God forbid, you get sick due to Covid, you canāt perform Umrah then. So a simple precaution goes a long way in keeping you safe. The accepted Covid vaccines are two doses of AstraZeneca / Moderna / Pfizer or two doses of Sinopharm. Additionally, you need a booster dose of AstraZeneca / Moderna / Pfizer.
VFS Tasheel International
The headquarters of VFS Tasheel are located in Dubai. Itās an authorized visa outsourcing partner for MOFA (Ministry of Foreign Affairs), Saudi Arabia. You can get visa services from here and for understanding where to go (location), check this link: https://www.mysaifco.com/vfs-tasheel-international-locations/
We will help you get a visa and perform biometric verification when you get our Umrah package from Dubai 2023. If you are unable to understand how to get a Saudi business visa , donāt worry. Get in touch with us and we will be happy to help you.
Happy Customers for Umrah Packages from Dubai
Since customer satisfaction has always been a priority for us, you wonāt have any complaints about our Umrah service Dubai. We make sure that your whole tour is smooth. If you face any kind of issue, we will more than happy to resolve that for you. We value customer satisfaction over money and our reviews speak for themselves. Look at how satisfied was one of our customers:
āSaifco Travel is one of the best Companies for Umrah packages in Dubai, they provide very good services, Iām extremely satisfied with their arrangement. Highly recommendedā
Hira Saleem, MANAGING DIRECTOR, MZ TRADING
So what are you waiting for? We will provide you with one of the best Umrah Packages from Dubai. Saifco Travel & Tourism is working tirelessly to offer you affordable packages which will be hard to turn down. Get in touch with us by sending an email to [email protected] . You can also Whatsapp or give us a call at +971 55 6337710
Related Searches
Send us a message.
Normally we are responding in 24 hours
Donāt wait any longer. Contact us!
- +971 55 633 7710 - Umrah
General Inquiry
Hi chat with one of our agent..
- Online Umrah ( Irfan )
- Online Tours Consultant (Chloe)
- Online Tour Operator (Shawal )
Use this feature to chat with our agent.
Automated page speed optimizations for fast site performance
Umrah Tour Packages
- Promotion āŗ
- Umrah Tour Packages from UAE
Embark on a spiritual pilgrimage to the holy cities of Mecca and Medina for a life-transforming journey. Seek the blessings of the almighty Allah, pray for forgiveness, and refresh your faith.
Musafir.com offers Umrah packages with complete arrangements at best rates for those who wish to perform Umrah.
For more information, get in touch with our holiday experts at 600544405 or email us at [email protected]
Fixed Departure Umrah Tour
Fixed Departure 23 - 27 August, 2023 ...
Umrah Tour by Bus
Explore the holiest city for Muslims ...
- Privacy policy
- © Universal Travels & Tourism LLC Sole Propritorship
Umrah Packages from UAE
Umrah is an Islamic pilgrimage to mecca (the holiest city for muslims,that can be performed at any time of the year.
Umrah requires Muslims to perform two key rituals,Tawaf and . Tawaf is a circling round theĀ Kaaba . it is recommended to do the first three circuits in a hurried pace, followed by four rounds of a more leisurely pace. This is followed by Sa’i betweenĀ Safa and Marwah Ā in theĀ Great Mosque of Mecca , a walk to commemorateĀ Hagar ‘s search for water for her son and God’s mercy in answering prayers. Pilgrims conclude the pilgrimage withĀ Halq , a partial or complete shortening of the hair.
Maximum of 100,000 pilgrims will be able to perfom umrah daily,and 60,000 worshippers will be able to pray at the mosque.
It is through Tawakkalna Application the permits are issued.
Umrah Package by flight Options
Umrah package 4 star hotel.
- Return Flight Tickets
- Accommodation
- Land transportation
- Juma at Makkah
- Guide assist at KSA
- Double sharing Accommodation
- Muqeem Registration
- Tawakkalna app assist
- Ihtamarna app assit
Umrah Package 5 Star Hotel
Terms and conditions:
- Above 18 years old are eligible for Umrah
- Saudi approved vaccine or chinese vaccine with one Pfizer booster is Mandatory
- Pcr test before departure and return is mandatory.
Documents required for Umrah visa
- Orginal Passport ( Passport should be valid for 6 months in which the UAE resident visa must be valid for atleast 3 months).
- One passport size photograph
- Emirates ID copy
- NOC letter in English or Arabic from the Sponsor
- Negative Covid results which is valid for 48 hours.
- ONLY UAE resident visa holders will be able to apply for Umrah visa from UAE.
Umrah Package by Bus from Dubai and Sharjah
Seaman Tours also have Umrah package by bus from three different locations which are Gold Souq bus station, Abu hail and Saudi Mosque which is located in Sharjah.Ā
By bus package is 10 days package which includes 5 days in Makkah, 3 days in Madinah and 2 days which will for traveling to the destination and coming back. We also have guide available for 2 of our bus packages who will guide us throughout the pilgrimage.Ā
The below rates mentioned below is on triple sharing basis. If you require any further clarifications you can also ways get in touch with our experts.
Gold Souq Deira
- 2 & 3 star Hotels accommodation
- Including Guide
- Desert Safari
- Quad Bikes and Buggy
- Cultural Thematic Tours
- Family Friendly Tours
- Holiday Seasonal Tours
- Indulgence Luxury Tours
- Outdoor Activates
- Relaxation Tours
- Wild Adventure Tours
- Switzerland
- Saudi Arabia
- View All …
- Umrah From Sharjah ā Dubai
- Performed Umrah By Bus
- Apply Umrah Visa
- Dune Buggy Desert Safari Dubai
- Desert Safari with Quad Bike Dubai
- Quad Bike Desert Safari Dubai
- Dune Buggy Ride Dubai
- Polaris RZR RS1 Single-Seater
- 4 Seater Dune Buggy
- Polaris Dune Buggy 2 Seater
- Private Desert Safari Dubai
- AMX DN80 80cc
- Buggy Polaris 2015 04 Seater 1000CC
- Buggy Polaris 2 Seater 1000CC
- Our Packages
- Tourists Visa
- Mainland Visa
- Global Visas (Schengen)
Umrah Services
Umrah Package – Dubai To Jeddah Flights Emirates
Umrah Package – Dubai To Jeddah By Bus
Umrah Visa From Dubai
Best umrah services in dubai, uae.
Avail the best Umrah services in Dubai and other emirates with NAS Trip – one of the leading Umrah travel agencies in UAE. We are pleased to offer our customers a range of Umrah packages to choose from, catering to all their needs and preferences. Our packages are carefully designed to provide a seamless and hassle-free Umrah experience to our valued customers. Show More
Top Umrah Visa Service in Dubai
One of the primary concerns for anyone planning for Umrah is visa approval and visa price. Our Umrah visa service prices are highly competitive and affordable, enabling our customers to perform Umrah without worrying about visa expenses. We have a team of experienced visa experts who assist our customers in obtaining their Umrah visa whether it is an Umrah e-visa or multiple entry Saudi visiting visa, by making the process smooth and stress-free.
Best Umrah Packages from UAE
Our Umrah packages from Dubai and other emirates including Abu Dhabi, Sharjah, and Ajman are one of our most popular packages, catering to the needs of travelers from Dubai and nearby emirates. The package includes visa processing, round-trip airfare or bus fare, hotel accommodation in Makkah and Madinah, and ground transportation, among other amenities. We have partnered with some of the best hotels in the haram areas to ensure our customers have a comfortable and enjoyable stay during their Umrah journey. Our packages are tailored to meet the needs of individuals, families, and groups, ensuring everyone can perform Umrah at their convenience.
In addition to our standard packages, we also offer customized Umrah packages to suit our customers’ specific needs and preferences. Whether you are looking for a budget-friendly package or a luxury package, we have got you covered. Our team of travel experts works closely with our customers to create a personalized Umrah package that meets their unique requirements. NAS Trip Umrah services in the UAE offer a range of Umrah packages designed to provide a hassle-free and comfortable Umrah experience. Our competitive Umrah visa prices, coupled with our exceptional customer service, make us the preferred choice for the best Umrah travel agency in the UAE.
# 201, 2nd Floor, Pizza Hut Building | Near Burjuman, Dubai
Email : [email protected]
- [email protected]
- +9714 3406668
Ramadan 2024 Umrah Package by AIR
>2 Nights Madina >3 Nights Makkah
5 Days Umrah Package by Air
> Four Star Hotel > 3 Nights Makkah >2 Nights Madina
Feb Umrah Package by Air
AL SHAMMAR UMRAH
Best Umrah Service in Dubai
5 Days Shawwal Umrah Package by Air
Ramdan Umrah Special Package by Flight Saudi Arilines
Ramadan Umrah Package by Bus
Every Wednesday Departure from Dubai and Sharjah
3 Star Hotel Umrah Package
Every Tuesday Departure from Dubai Intl Airport by Saudia
5 Star Hotel Umrah Package
90 Days UAE Travel
30 Days UAE Travel
Saudi Business Travel
Oman Travel and Tourism
VISIT DUBAI & EXPLORE THE WONDERS
Explore The Amazing City
Dubai TourismĀ | 90 Days Trip to UAE | 30 Days Trip to UAE | Hotel Booking | City ToursĀ | Dhow Cruise | Desert Safari | Abu Dhabi Tours | Burj Khalifa
Umrah Package from Dubai 2022
Umrah Service from Dubai
We can facilitate our customers to apply umrah travel document and Umrah packages from Dubai/UAE in best and easy possible ways without going through any hassle.
Client Satisfaction
do i need pcr test to enter saudi arabia for umrah .
No PCR Test Required to travel for Umrah from Dubai
? Can a visitor in UAE apply for Umrah travel document?
NO, Only UAE Residents can apply for Umrah
? Can single woman perform Umrah without mahram ?
Customer reviews.
Al Shammar Umrah Service provide best Umrah package from Dubai and Sharjah, we provide Umrah Package by Air , Umrah Package by Luxury Bus and Customized Umrah Package
Our Umrah Pacakes
- Umrah Package Dubai
- Umrah Package by Air
- Umrah Package by Bus
- Umrah Package by Flight
- Customized Umrah Package
Umrah Travel Dubai
- Umrah from Dubai
- Umrah Travel Details
- Umrah Travel for Kids
- Umrah Tour from Dubai
- Umrah Package from Sharjah
Get Umrah Updates
Call to Umrah Experts
Al Shammar Umrah Service - Best Umrah Service in Dubai | Web Site Developed by Altronz Digital Solutions
WhatsApp us
- Contact Old
- Travel Insurance
Umrah package by Air from Dubai, UAE
Elevate your spiritual journey: umrah package by air from dubai, uae, umrah by air from dubai includes.
- Umrah visa.
- Experienced guide.
- Makkah and Madinah hotel.
- Transfers in Saudi Arabia.
- Breakfast inclusion in 4 star and 5-star packages.
- Historic places visit.
- Return airline ticket.
- Guide will accompany with the group for the complete guidance
- Male should wear ihram from Dubai airport masjid
- Female wear ihram from Home and niyyath from Airport Masjid
Trip Itinerary
• 2:00 pm: start from Madina airport to Madina al Munwwara by luxury bus with guide • 3:00 pm: reaches at Madina Munawwara and check in to hotel • Hotel maybe change to same standard subject to availability • Attend Magrib and Isha prayer at Masjid Al Haram Madina Munwara After prayer visit Roudah Shareef • For offering prayer at Riyadh al janna please download Nusuk application • Select visitor tab and register using your email id, passport number and saudi visa number. • Login and select slot according to your time
• Perform fajr prayer at Madina masjid • On 7 am visit holy places of Madina Munawara with guide • Return to Madina al Munawara Haram Shareef and pray Duhr. • Pray Asar prayer and go with guide to Jannath al Bakhee...(Madina Qabaristan) optional • Pray Magrib and Isha at Masjid Nabawy
• Pray Fajr prayer at Haram and Visit Rasool (s) • on 10 am make ready depart to Masjid shajra (meekath for ihram) • 4:00 pm reaches makkah and check in makkah: • Hotel maybe change to same standard subject to availability • After check in hotel walk to Haram Shareef with guide and do Umrah. • Pray magrib and isha prayer at Haram, perform Umrah
• Pray Fajr prayer at Haram and attend Juma prayer • Try to do tawaf between Isha and Magrib
• After fajar prayer go to hotel. • At 7 AM Departure with guide to visit holy places in Makkah al Mukarram • The guide will explain about the history and importance of the above holy places. return from holy place and attend duhr prayer at haram shareef. • After asar prayer.... visit jannath al muhalla... (makkah qabaristan) with guide (optional) do magrib prayer and perform tawaf and pray isha • After isha prayer... if any body wish to perform umra again guide will help you
• Pray fajr prayer at haram do tawaf al wida..(farewell) • After finished tawaf al wida go to hotel and make break fast and check out the hotel and departure to jeddah airport • Return to dubai by saudi airlines.
Required Documents for Umrah visa
- Original passport validity 6 months residence visa validity 3 months
- 1 passport size photo in white background
- Emirates id copy
Step by step guide to perform Umrah by Air from Dubai on-flight umrah
Spiritual Preparation: Sincerely reflect introspect and spiritual preparation, appreciating the importance of Umrah and its rites.
Educate Yourself: Learn about the practices of Umrah from a credible source or someone experienced in these rituals.
Travel Arrangements: Use a reliable travel agency such as Go Kite Travel to plan for your journey, where you will find all necessary arrangements including visa, accommodation and means of transport to take care before even arriving in the country.
Spiritual Reflections: In the course of your stay in Makkah and Madinah, be in the place of spiritual reflection and divine closeness.
Historic Site Visits: Visit the historic sites, envisioned in a manner of reverence and contemplation to participate in the Islamic heritage.
Guidance from Experts: With Go Kite Travel, you are accompanied by incredibly knowledgeable guides who make the religious and historical importance of each site more understandable.
Community Engagement: Connect with other pilgrims, discussing their experiences and building the community of such a holy journey.
When you choose Go Kite Travel for your spiritual Umrah tour by Air, itās not just a journey you begin; itās an experience that will indeed be transformatory and be with you for a life time.
Advantages of Performing Umrah by Air from Dubai
Umrah package by air cost, umrah by air economy package charges.
- Quad: AED 3200 per person
- Triple: AED 3300 per person
- Double: AED 3400 per person
- Child: AED 3000 per person
- Infant: AED 800 per person
Umrah by air 4 Star Package charges:
- Quad: AED 3700 per person
- Triple: AED 3900 per person
- Double: AED 4300 per person
Umrah by air 5 Star Package charges:
- Quad: AED 4400 per person
- Triple: AED 4600 per person
- Double: AED 5100 per person
Note: While 5-star rates can change according to situational or seasonal variables. The Luxury of air travel add on to bless your spiritual journey. Our 4 star and 5-star packages offer luxurious comfort in addition to spiritual indulgence, our economy package also gives you an affordable yet profound experience. With Go Kite Travel, it is possible to combine luxury travel with sacred meaning, making for the most unforgettable Umrah experience yet.
Frequently Asked Questions
However, air based Umrah packages are better because they take less time to reach to the destination thereby ensuring a speedy and comfortable journey.
While the airlines may differ, packages usually come with direct flights to Saudi Arabia by some of the most reputable carriers.
Indeed, air packages provide a fast, relaxed and more time to spend at holly sights in Makkah and Madinah.
However, the benefits of saving time and traveling in luxury make the Umrah by air packagesā cost seem costly compare to the umrah by bus, which is somewhat reasonable.
Umrah visa assistance, professional guides, hotel arrangements, local transportation in Saudi Arabia, Historic Place Visit Makkah and Madinah and back air tickets are the basic inclusions.
Certainly, Umrah by air packages are available in individual and group bookings but can be customized to suit different preferences.
Price may very during off peak seasons and other promotions hence one should validate the prices with agency.
To apply or book Umrah from Dubai, UAE one needs to have a valid passport, valid UAE residence visa and Photograph with a white background.
Umrah package from Dubai
The best-selling Umrah Package from Dubai is provided by Bakhla Tours & Travels. As we know after the COVID-19 situation pilgrims from all around the world need to be fully vaccinated to perform Umrah. The main office of Bakhla Tours & Travels is in India but they have a record of serving pilgrims globally. Any pilgrim wanting to perform Umrah from Dubai holding a residence visa and any foreign nationality passport Bakhla Tours & Travels can help them in planning their journey of Umrah.
Advantages of booking an Umrah Package from Dubai
The main advantage of booking an Umrah Package from Dubai via is that we carve out the best possible facilities with the nominal cost for any pilgrim. The duration of this self-purification journey can be customized by the pilgrim itself. The most demanding and best-selling package consists of 5 Nights Makkah and 3 Nights Madinah. You as a pilgrim should be perfectly aware of the accommodation and the type of transportation which will be provided to you by the travel agency. You can follow us on Instagram: bakhla.tours Facebook: bakhlatours
Recommended:
Hajj Packages Umrah Packages Ramadan Umrah Packages Umrah Packages from Mumbai 2022 Hajj Packages 2022 Best Umrah Package
Umrah Packages in Dubai
Umrah is an Islamic pilgrimage that can be performed many times in a lifetime by being physically and financially capable of doing so. Meanwhile, there are many Umrah packages in Dubai which are perfect for those looking to do an Umrah but don’t want to worry about the planning and organizing. It has all the services you need like transport, accommodation, food, and guidance. On the other hand, you can also make sure that it includes everything you want, by customizing your Umrah package from Dubai to your personal needs through the website and with the help of a salesperson. This article covers some tips for choosing the best package of Umrah to the holy cities of Makkah and Madinah.
Tips To Plan Umrah In Post Pandemic Situation
Planning your Umrah pilgrimage is a difficult task in a post-pandemic world.Ā There are many things that you need to do before embarking on this journey. Be sure you have your vaccinations and all the documents needed for your trip. If this sounds like too much work, it might be best to plan ahead of time and do some research about the Umrah package from Dubai , if you want to perform umrah pilgrimage from United Arab Emirates. Already, there’s a lot of competition for business travel packages and considering what’s happening with the world right Ā now, Ā and it might be best to book as soon as possible. Wear masks and long sleeves in crowded places. It is important to protect yourself from the diseases that are spreading. Be sure to wash your hands often. Quarantine yourself if you feel feverish. Don’t take any chances when it comes to health.
Who Is Allowed For Umrah Pilgrimage from Dubai
Those allowed for Umrah pilgrimage are people with a permitted Umrah visa, and the other is those with residence visa of Dubai. The people with a valid residence visa of the U.A.E. can take the advantage of the opportunity to perform Umrah from Dubai with booking an Umrah Package with us.
Umrah Packages By Air
The best Umrah packages from Dubai tend to be those that cover the airports which has a variety of flights which differ in prices and timings. Planning an Umrah Package from DubaiĀ by air can save you a lot of time and energy. Travelling from Dubai to Saudi Arabia by air will lead to less stress physically for the pilgrims travelling. As usually pilgrims land on Jeddah internationalĀ Ā airport and from there the holy city of Makkah where Umrah is performed is 150 kilo meters away. Some of the best Umrah packages air tickets are offered by airlines like Emirates and Qatar Airways.
What Are the Best Umrah Packages By Bus
Umrah Packages Dubai are on the rise, and the increase in demand has resulted in numerous bus operators offering cheap transportation by bus for Umrah journeys. The cheapest option is the air-conditioned bus service that runs from Jumeirah to Makkah and back. Ā Dubai to Umrah package options include bus transfers from many cities like Dubai, Sharjah,
Meals Offered In Dubai to Umrah Package
Meals are in the Dubai to Umrah packages are offered in the hotels of Makkah and Madinah on full board, half board and Breakfast only basis. These packages are suitable for individuals who would like to have a complete break from their routine and seek spiritual comfort. The package includes daily meals which are chosen by the pilgrims traveling. The meal by the hotels are provided in different cuisines.
Who Can Travel For Umrah?
For Muslims to take part in Umrah, they can be of any age for Dubai Umrah Package but as per COVID-19 norms the age is set above of 14 years. Umrah is a pilgrimage to Makkah that can be performed any time of the year except during the time of hajj. Every Muslim can perform Umrah as many times as they want. To travel for Umrah, they must have a valid passport, have enough money saved up and have a compatible Umrah visa.
We Offer Customized Umrah Packages from Dubai
We offer customized packages for our clients, and we help you with the entire process of your Umrah package. Our packages include air tickets, airport transfers, accommodation and meals if needed.Ā If you are looking for a customized Umrah package from Dubai, we offer you the best services for your pilgrimage journey. We have packages that cover all your needs, and with our professional team at your service, we can ensure that you get all the necessary services in the holy cities of Makkah and Madinah when you book an Umrah Package wit us. Your plan from 5 nights to 15 nights, and we can help you make all the arrangements.
You can find two stars to 5-star hotels in Dubai to match your budget, and you will be satisfied all the facilities from those hotels with our customized Umrah packages. After you reach Jeddah airport everything will go accordingly as planned for your package in the holy cities of Makkah and Madinah.
We Offer Multiple Departure Options by air
When it comes to Islamic travel packages, we offer Umrah Packages in Dubai and all over the United Arab Emirates (UAE). Umrah Packages Dubai consist of flights, accommodation and transportation from Makkah to Madinah. For those looking for a low-cost Islamic package deal, we have special offers on Umrah Packages from UAE. Our departure options include Dubai, Sharjah, Abu Dhabi, Ajman and Jebel Ali. It helps you save time as you can depart from any of the city which is near from you.
We Guarantee Umrah Visa & Umrah Performing Slot
Bakhla Tours & TravelsĀ offer an Umrah Visa service to facilitate a hassle-free journey for all the passengers who booked their Umrah Package through us. Our Travel agency have a wide variety of Umrah packages from Dubai which includes an economic and luxury ranges. We guarantee Umrah Visa & Umrah performing slots for all the passengers booked through us. This helps us to provide hassle-free travel and prayer facilities for all the passengers booked through us. This activity of booking an Umrah slot can be full filled with the help of EATMARNA & TAWAKKALNA applications with the help of necessary documentation.
We Have Packages To Perform Local Ziyarat in Makkah & Madina (Optional)
Our packages ensure that you get all of your pilgrimage and prayers done. We have packages with great rates to perform local ziyarat in Makkah & Madina. We have packages with great rates to perform local ziyarat in Makkah & Madina. A visit to more religiously and historically important places will help the pilgrim to see places which they never knew about.
NOTE : PACKAGE DETAILS ARE TENTATIVE CAN BE CHANGE WITHOUT PRIOR NOTICE.
Phone: +91 88000-15676
Mail: [email protected]
Umrah with Dubai (Deluxe Package) 15 Days ( 07 N Makkah,04 N Madina & 03 N Dubai )
Umrah with dubai (deluxe package).
Umrah is the lessor or minor pilgrimage undertaken by millions of Muslims every year to wash off their past sins and rejuvenate their faith. Umrah is performed in Masjid al-Haram which is the home of Kaāba. Kaāba in Arabic means cube or a square building which is covered in elegant silk and cotton fabric. It is considered as the holiest shrine in Islam because all the prayer mats are directed towards the Kaāba, even mosques are constructed in such a manner that they face towards it. Pilgrims circumambulate the holy Kaāba and kiss al-Hajar al-Aswad , the black stone embedded in the eastern corner of the Kaāba.
This package has been designed for those who would love to visit Dubai for holidays after performing Umrah. The components of this package will allow the pilgrims to perform umrah with utmost respect and devotion with any haste or missing on any ritual. Our organization will manage the pilgrims in Dubai as well. This package is the best opportunity to experience the exotic in the desserts of Dubai while being spiritual in Mecca and Medina.
Makkah Hotel
Emaar Grand /Al Massa Grand / Ramada or Similar 500 MTR
Madinah Hotel
ODIST /Zowar International /Haya Plaza/Haya Grand or Similar 200 MTR
Dubai Hotel
Sea View / Jacob Garden (4* Hotel)
Package Details
CHILD POLICY
Infant (up to 02 yrs of age ) 34,999/-
Child (02 to 06 yrs) without Bed 64,999/-
Child with Bed same as Adult.
(SAUDI) UMRAHPACKAGE INCLUSIONS:-
- Round trip Flight (DEL JED DXB by Saudi Airlines & DXB DEL by Air India/Indigo )
- Umrah visa with insurance
- 12 days (07 Nights in Makkah & 04 Night Madinah)
- Stay in a 4star hotel Makkah & Madinah
- Distance till Mecca hotel from divine boundaries is 500 M
- Distance till Madinah hotel from divine boundaries is 200 M
- All Transportation by Private Car
- On the arrival at King Abdulaziz international Airport will be transported to the assigned hotel in our private car
- Ziyarat tour of Mecca and Medina under the supervision of an experienced tour guide by Private Car
- Laundry services
- Complimentary 5ltrs Zam Zam for every individual
- Talbiya Umrah kit
- Local staff to assist you
- 24x7 customer support
DUBAI PACKAGE INCLUSIONS.:-
- 4 Days stay in a 4star hotel (03 nights accommodation)
- Dubai visa with insurance
- Breakfast at hotel
- Two way Dubai Airport Transfer
- Dubai city tour for half day
- Dhow cruise with dinner at creek
- Dessert safari with BBQ dinner (4X4 land cruiser )
- All tours and travel on SIS basic
- GST 5% and TCS 5%
- Facilities and services which are not mentioned in the package
- Charges apply on extra luggage
- Tour operator/guide not responsible for loss of luggage
- Room service strictly depends on housekeeping department
- 10 AED to 20 AED Per Person/ Per Night Tourism Dirham (Payable at Dubai Hotel only )
- Anything which is not include
Requirement
- A bona fide Passport which is valid for another 6 months
- Passport size photograph which should have a white background
- Vaccination certificate
Payment Terms
- NR 9,999/- is the booking amount
- 50% amount to be paid before the booking
- Balance and rest of the amount to be paid after equipping pilgrim with visa, insurance, hotel and transport
- We accept payment only by bank transfers, NEFT and RTGS. We donāt deal in hard cash
Cancellation Policy
- 50% Amount (paid prior booking) + 9,999 (booking amount) are not refundable
- Packages are thoroughly non-refundable. No claims will be entertained during the time cancellation
- Dates may differ due to airline rates
- No refunds can be claimed if the person fails to acquire a clearance at immigration owing to any government policy/rule COVID guidelines
- No refund if the stay is curtailed
NOTE (Terms & Conditions)
- Vaccination certificate indicating that the person is fully vaccinated
- Rates may differ during festive season ( Muharram, Ramadan,Eid and Eid-Milad- Un-Nabi etc)
- No airfare applicable on low cost airlines.
- 1 SAR= 20.80 INR but if there is any variation noted in SAR then the amount have to paid prior to departure
- Hotel with identical or similar qualities and amenities will be provided in case the assigned hotel happens to be inaccessible due to unforeseen reasons
- The distance from Masjid e Nabawi and Haram Sharif till hotel may differ on different platforms ( we calculate distance from the boundary of Haram sharif and Masjid e Nabawi up to the hotel)
- Tour programs and tours dates are tentative and subject to change without any notification.
- Tour operator/guide will not be held accountable for the loss of luggage
- Laundry service will be provided 2 Ć in Mecca and 2 Ć in Medina
- Fixed timings should be followed for Ziyarat and meals
- Toiletries like towels and buckets will not be made available in the hotels of Mecca and Medina
- We will not be held responsible for Loss or Theft of passports or luggage at Airports.
- Pilgrims requiring wheelchair are suggested to carry their own wheelchair
- We will not be held responsible for any rejection, delay and/or any mistake in visa from KSA/Dubai embassy and visa fees is non refundable
- In case of PASSPORT SEND TO EMBASSY while processing visa for umrah, we are not responsible for rejection or any delay from the embassy neither we are responsible for the delay or deferral of flight
- In the case of PASSPORT SEND TO EMBASSY, the involved personās passport will be sent to the embassy which will be charged INR 2000/-. The process might take a considerable 3 to 4 working days. If the process is done through courier then charges may vary
- Subject to Delhi Jurisdiction only
Umrah Package Itinerary
Itinerary ( Tentative)-Saudi (Umrah package)
DAY 1--- The group will jet off to Jeddah . Private car will transport to Mecca hotel. After accessing the hotel and checking in the tour guide will take the group for Umrah
DAY 2--- Set off for Haram Sharif
DAY 3--- Ziyarat at local shrines in the supervision of tour guide
DAY 4--- Offer prayers at Haram sharif
DAY 5--- Visit Haram sharif and perform 2nd Umrah at Masjid Asha with assistance of tour guide but pilgrims have to manage their own transportation
DAY 6--- Perform 3rd Umrah and visit Masjid Asha but pilgrims have to manage their own transportation
DAY 7--- Offer prayers at Haram Sharif and/or explore Jeddah as per your convenience
DAY 8--- Pack your bags as we going to Medina
DAY 9--- After accessing Medina & set to visit Masjid e Nawabi
DAY 10--- Set off for Majid E Nawabi
DAY 11--- Set off Masjid E Nawabi
DAY 12--- Reach airport with your luggage to board the return flight to Dubai
Dubai Package Itinerary
Itinerary (Tentative)-Dubai package
Regal Tours
Office : +971-4-2635-888
Toll Free : 800 123 321 (UAE)
Umrah Package from Dubai
Umrah package from dubai 2024.
Starts from*
Are you planning for Umrah from Dubai ? Regal Dubai Travel Agency offers the best Umrah packages for families and individuals. Our Umrah packages are specially made for UAE residents and other nationalities, offering a VIP experience that includes Umrah visa , luxurious accommodations, roundtrip flights, and private transportation facilities.
Book your Umrah package with us and start your journey. Our experienced consultants will explain all the steps to submit accurate documents for Umrah package. Please note that seats are subject to availability, so we recommend you to book your package as soon as possible to secure your preferred dates.
Contact Regal Dubai Travel Agency today to book your Umrah package. Our team is ready to assist you with any questions and help you to plan the perfect Umrah trip.
Details of Umrah Package
Umrah package includes:.
- Umrah visa with insurance
- Roundtrip air tickets
- Makkah - Accommodation in Swissotel or similar with tasty breakfast
- Private transportation
- Jumuah in Makkah
What documents are required to get Umrah package from Dubai?
- Your Passport Copy
- 1 Passport size photo, any background color (We will change the background color according to the Embassy's approval requirements)
- Emirates ID (For UAE residents)
How much does it cost for Umrah package by flight?
Additionally, we have packages from Tuesday to Saturday for 2 nights and 3 days, with the following options:
A highly experienced Ameer will be with you throughout your journey to guide and assist you at all the Umrah related locations.
How do I apply for the Umrah Package from Dubai, UAE?
- Please send the copy of your passport, your Emirates ID copy (if youāre a UAE resident), and a clear photograph to WhatsApp us on Ā +971502315207 or by email us to [email protected]
- Once we receive the documents, weāll share with you the online and offline payment methods.
- The required service fee is to be paid.Ā
- Once your Umrah visa is issued, we will prepare all other arrangements and will send you the details by WhatsApp or email to in 7 working days.
- Once everything is ready in your hand, you can start your successful Umrah journey by flight.
How do I pay for my Umrah Package from Dubai?
- Once we have received your above documents, we will reply to you with the online & offline payment methods.
- We accept all types of online & offline payment methods including accepting all credit / debit cards and crypto.
- You can pay to our agency bank account, the payment can also be done at Regal Tours office by cash or card.
- You can also pay us through any money exchange near to you.
Got More Questions?
- If you have any more questions or if you need any further help, please call us any time you want, or send us aĀ WhatsApp message, or send us an email .
- All our office emails are guaranteed to be replied within a maximum of 1 business hour.
- You can also use the below query form to get in touch with us.
Your Email Address
Your Mobile Number
I have WhatsApp on same number
Your WhatsApp Number
You are in which country now?
Your message to Regal I want
Frequently Asked Questions
Umrah package starts from AED 4800
Original Passport (6 months validity upon travel)
Valid UAE visa
Passport size photo – any background & any size is acceptable
It will take 5 to 7 working daysĀ
We have two Umrah packages:
- Every Thursday to Sunday: 3 nights and 4 days
- Every Tuesday to Saturday for 2 nights and 3 days,
Office: +971 4 2635 888
Toll-Free: 800 123 321 (UAE)
Email: [email protected]
2021 Umrah Package from Dubai by Bus - What You Need to Know
Blog Details
Going on an Umrah pilgrimage is a once-in-a-lifetime experience for many, and with the availability of affordable 2021 Umrah package from Dubai by bus , it is now possible to make this dream come true. Learn all you need to know about this tour, including the cost and duration of the journey.
Duration and Inclusions of the Tour.
The 2021 Umrah package from Dubai by bus is a 10 day/ 8 night tour that includes round-trip transportation by air-conditioned coach, three star hotel accommodation in Makkah and Madina, five nights in Makkah and three nights in Madina. The package also includes ziyara depends on PRO advice in saudi Arabia, tours of important holy sites, such as the Masjid al Haram. In addition, other important services like local PRO assistance, transportation to historical and religious sites, 24 hours assistance and many more are included in the package. Opseon.com offer 10 days umrah package service from Dubai for UAE pilgrims to perform umrah.
Umrah Valid Travel Documents.
Book your 2021 umrah package from Dubai by bus with Opseon.com and have a worry-free trip. All tours organized by the agency are fully compliant with Saudi Arabiaās Ministry of Hajj and Umrah regulations, both in terms of safety as well as its social distancing protocols. To ensure a successful visa application, you need to submit valid travel documents such as a passport which should be valid for at least 6 months after the date of departure, an original Emirates ID for UAE residents, one passport size photos, and AED 1500 per person. When booking your package with Opseon.com make sure to supply all relevant information so they can arrange a hassle-free experience during your stay in Makkah and Madina.
Umrah Package From Dubai
Apart from that, the Umrah package from Dubai by bus also includes Visas application services without any hidden charges and ziyarat service to important sites like Masjid al Haram. Makkah and Madina tours are fully organized to give travelers a cultural experience they will never forget. Besides all the luxuries included in the 10 day/ 8 night package, you will be accorded full practical assistance with facilities such as local transport for shopping areas, Mosques and other holy sites.
Umrah Hotel Accommodation
Whichever package you decide to book, be assured that your time spent during the 2021 Umrah package from Dubai by bus will be safe as well as accommodating. Your travel specialists have worked hard to make sure that travelers experience the best umrah journey with no hassle or inconvenience. To ensure that everyone experiences a peaceful and comfortable stay for their religious purposes, hotel accommodation has been booked according Opseon.com's policy of only keeping lodging in three star hotels close to important holy sites. Additionally, meals will be the responsibility of travellers.
Reserve Your Umrah Pilgrim For You And Family
Overall, this Umrah package from Dubai by bus offers excellent value for money and is the perfect way to experience Makkah and Madina during Ramadan time.
Opseon Umrah package for 10 days on all Wednesday start from sharjah Saudi mosque and reach makkah on next day night. Reserve your umrah pilgrim for you and family in Dubai United Arab Emirates.
Used cars for Sale in Dubai UAE
home pcr testing service uae
FIFA 2022 World Cup FootBall Qatar Bus travel trips from United Arab Emirates
UAE Multiple Entry Visa for HAYYA Card Holders
2022 FIFA World Cup Match Visit Qatar
Bus Reservation
UAE visa change
Ejari registration centers in Dubai
7 Things You Should Know Before Buying a Used Car in Dubai?
5 Best Sources to Buy Quality Dubai Car Used
Top 5 Benefits of Buying Certified Pre-Owned Cars in UAE
A Comprehensive Analysis of the Used Cars Market in Dubai
Dubai to Jeddah by Bus
Guide to PCR Test Dubai: What You Need To Know
How to Book a Covid-19 PCR Test in Dubai?
Guide to Bus Rentals Dubai: What You Need to Know
Virtual Ejari For License in Dubai
Virtual Ejari Rental Contract
Virtual Office Ejari in Dubai
What Are the Most Popular Cars Used Dubai?
Finding Quality Used Cars for Sale in UAE
10 Best Umrah Package From Abu Dhabi to Consider
Top 10 Umrah Packages From Dubai - Reviews and Prices
What You Need to Know About PCR at Home Abu Dhabi
How to Check Your Emirates ID Case Status Online
Where to Find the Best Deals on Used Dubai Cars?
How to Save Money on Bus Rental Dubai?
Dubai to Jeddah by Bus Travel Guide
Dubai Used Cars Market.
14 Seater Hiace Minivan For Rental in Dubai
Covid 19 PCR Test At Home in UAE
Travel From Dubai to Saudi Arabia by Bus
Office Rent in Dubai ā Find the Best Deals
Office Space for Rent in Dubai
Ejari Typing Center in Dubai - Are They Worth It?
Ejari Download Made Easy: A Step-by-Step Tutorial for Dubai Property Owners
Navigating Dubai Mainland License Renewal and Ejari for Office, Warehouse, and Shop
Streamlining Business Operations in Dubai Mainland: A Comprehensive Guide to Ejari, License Renewal, and More
The Ultimate Guide to Virtual Ejari for hassle-free License Renewal in Dubai
Renew Your Dubai License in Just 60 Minutes with Virtual Ejari
Join as a provider, join as a user, login opseon, join as partner / user.
IMAGES
VIDEO
COMMENTS
For more details call: +971 50 421 8331. Click To Call. OR Email: [email protected]. Ramadan Umrah Package By Bus From Dubai & Sharjah. (10 Days Package) Available Dates. Total Nights. Price Per Person With Visa. Dep: 06-Mar-2024.
An Unforgettable Umrah. Packages to suit your pilgrimage. Umrah - a long-awaited journey, a lifetime experience. At Emirates Holidays, we understand the importance of making your Umrah pilgrimage as special and sacred as possible, which is why we've customized packages just for you. From hand-picking hotels in Makkah that are within walking ...
Our Umrah by bus package includes an umrah visa, 3- to 4-star hotel accommodations, and transportation from Makkah to Madinah. Whether you book a bus ticket from Sharjah, Dubai, or Abu Dhabi, the luxury bus fare to Makkah- Madinah is included in the package and is relatively inexpensive. We arrange Umrah by bus departure every Wednesday.
Born from a vision to fulfill peoples' dreams to go for pilgrimage, Umrahme has, since 2017, specialized in comprehensive Umrah packages. We offer a selection of all-inclusive Umrah Packages, ensuring every pilgrim is accommodated, alongside curated stays in the finest Makkah Hotels and Madinah Hotels. Our essence is to offer more than just ...
Triple : 2500 AED. Double : Call For Price. Note : *400 AED will be deducted from the above packages, if you already have Saudi Visa. (Limited Time Offer) For Booking & Details Call : +971 50 421 8331. UMRAH PACKAGE BY BUS INCLUDED. Umrah Visa With Insurance. Complete Sharing Transportation.
We have special Umrah Packages Like Umrah by Luxury Bus or Umrah by Air both convinces and flight departing according to schedule from Dubai, Sharjah and in all UAE. We have a large number of expert schemes with affordable and customised Umrah Packages for pilgrims Like 2-star, 3-star, 4-star economy, Golden, silver and customise.
Get Umrah Packages From Dubai. Umrah Package By Bus, Umrah Package By Air With Umrah Visa, Transport and 3, 4, 5 Star Hotel Accommodation. // // Please wait. ... Dubai Tours. Umrah Package From Dubai. Travel Insurance From Dubai. Hot Deals. HOT AIR BALLOON TOUR. Location: Dubai. From AED 1049. ESCAPE TO MUSANDAM. Location: Depend.
These include arranging Umrah visas, identifying fake agents, the hotel's location, transportation facilities, and Ziyarat tours. We offer the most astounding Umrah trip of your life, so contact us if you are looking for reputable and reliable cheap Umrah packages from Dubai. We are a reputable Umrah packages provider based in Dubai. Our ...
Best Umrah Packages. Embark on a š¬š©š¢š«š¢šš®šš„ šš¦š«šš” š£šØš®š«š§šš² with #musafirdotcom. Pay homage at Masjid al-Haram & Al Masjid al Nabawi, while performing Mazarats & Ziyarats in Makkah and Madina with free Saudi eVisa, flights, accommodation, daily breakfast and more. Call us at 600 544 ...
Umrah; 5 Star VIP Umrah Packages from Dubai. Those looking to enjoy their experience at the holy sites in the most comfortable manner will appreciate our 5-star Umrah packages. Keeping their needs in mind, we have designed 5-star Umrah packages. With our 5 Star Umrah package, you'll stay at 4 and 5 star hotels in Makkah and Madina.
Call: +971 50 417 3057. Umrah package from dubai & sharjah. Umrah package by bus and umrah package by air with umrah visa & 3,4,5 star hotels in makkah and madina. Umrah packages for individual and family.
Saifco Travel & Tourism is working tirelessly to offer you affordable packages which will be hard to turn down. Get in touch with us by sending an email to [email protected]. You can also Whatsapp or give us a call at +971 55 6337710. Umrah Packages From Dubai. All included umrah package from Dubai 2023.
2022āŗ. Umrah Tour Packages from UAE. Embark on a spiritual pilgrimage to the holy cities of Mecca and Medina for a life-transforming journey. Seek the blessings of the almighty Allah, pray for forgiveness, and refresh your faith. Musafir.com offers Umrah packages with complete arrangements at best rates for those who wish to perform Umrah.
Umrah Package by Bus from Dubai and Sharjah. Seaman Tours also have Umrah package by bus from three different locations which are Gold Souq bus station, Abu hail and Saudi Mosque which is located in Sharjah. By bus package is 10 days package which includes 5 days in Makkah, 3 days in Madinah and 2 days which will for traveling to the ...
Best Umrah Services in Dubai, UAE. Avail the best Umrah services in Dubai and other emirates with NAS Trip - one of the leading Umrah travel agencies in UAE. We are pleased to offer our customers a range of Umrah packages to choose from, catering to all their needs and preferences. Our packages are carefully designed to provide a seamless and ...
Al Shammar Umrah Service provide best Umrah package from Dubai and Sharjah, we provide Umrah Package by Air , Umrah Package by Luxury Bus and Customized Umrah Package. Our Umrah Pacakes. ... Umrah Tour from Dubai; Umrah Package from Sharjah; Get Umrah Updates +9714 3406668. Call to Umrah Experts .
Umrah tour by air from Dubai with Go Kite Travel makes divine pilgrimage beyond expectations. Experience the Holy splendour of Makkah and Madinah as our seasoned guides leads you through a smooth spiritual path. Our comprehensive package starts to take care of your every need from the moment you step on board, ensuring that you concentrate ...
Feel lucky enough to see the blessed cities of Makkah and Medinah with tour agent guiding about important religious commitments and Sunnah. Revive Islamic history by visiting ziarats and much more perks in your all-inclusive Dubai Umrah Packages. Clifton Tours is offering Dubai Umrah Packages by Air and Bus. Each of these tours is of the ...
The best-selling Umrah Package from Dubai is provided by Bakhla Tours & Travels. As we know after the COVID-19 situation pilgrims from all around the world need to be fully vaccinated to perform Umrah. The main office of Bakhla Tours & Travels is in India but they have a record of serving pilgrims globally. Any pilgrim wanting to perform Umrah ...
Umrah Package Itinerary. Itinerary ( Tentative)-Saudi (Umrah package) DAY 1--- The group will jet off to Jeddah . Private car will transport to Mecca hotel. After accessing the hotel and checking in the tour guide will take the group for Umrah. DAY 2--- Set off for Haram Sharif. DAY 3--- Ziyarat at local shrines in the supervision of tour guide.
Book your Umrah package from Dubai with Regal Dubai Travel Agency. We provide the best Umrah packages for families and individuals. Please visit our website for more information. Regal Tours | | +971 508474794. ... Tour Packages; World Visit Visa Services from GCC Countries;
Umrah with Dubai tour packages. Experience the tranquility of performing Umrah, followed by an exhilarating exploration of the vibrant city of Dubai. Our carefully curated packages offer a perfect blend of spirituality and luxury, ensuring a seamless and memorable trip for you. Immerse yourself in the Holy Citys of Makkah and Medina, then ...
The 2021 Umrah package from Dubai by bus is a 10 day/ 8 night tour that includes round-trip transportation by air-conditioned coach, three star hotel accommodation in Makkah and Madina, five nights in Makkah and three nights in Madina. The package also includes ziyara depends on PRO advice in saudi Arabia, tours of important holy sites, such as ...