uae to uk tour packages

• +974 5059 3000
• [email protected]
• Georgia Tour Packages
• Switzerland Tour Packages
• Egypt Tour Packages
• Qatar Tour Packages
• Oman Tour Packages
• Bangkok Honeymoon Packages
• UAE Honeymoon Packages
• Sri Lanka Honeymoon Packages
• Maldives Honeymoon Packages
• Switzerland Honeymoon Packages
• London Family Packages
• Oman Family Tour Packages
• Doha Family Tour Packages
• Male Family Tour Packages
• Turkey Family Packages
• Doha Leisure Tour Packages
• Sri Lanka Leisure Tour Packages
• Jordan Leisure Tour Packages
• Switzerland Leisure Tour Packages
• Turkey Leisure Tour Packages

United Kingdom Tour Packages from UAE

• 10 - 12 Days
• 13 - More Days

Consisting of England, Scotland, Wales and Northern Ireland, UK is an island nation where Shakespeare was born. The capital of London, UK is the hub of finance and culture. Neolithic Stonehenge, Bath’s Roman spa and old universities at Oxford and Cambridge are found here.  It has been a favorite holiday destination that flaunts its stunning countryside, historic cities, museums and theaters. There is diversity seen in the medieval castles to stately mansions and stunning view of the lake district and Scottish Highlands. When it comes to making plans to visit UK, look into some of the UK tour packages from UAE .

• Cab Facilities
• Sightseeing
• Airport pickup-drop
• Room Service

Showing 44 United Kingdom Holidays Packages

• Price Low to High
• Price High to Low

Affordable 3 Nights 4 Days London and Manchester Vacation Package from UAE

Uncover the unparalleled charm of London and Manchester with our unbeatable vacation package! From iconic landmarks to hidden gems, immerse yourself in the rich history and vibrant culture of these two captivating cities with affordable 3 nights 4 days London and Manchester vacation package from UAE . Craft unforgettable memories as you explore renowned attractions, savor local delicacies, and revel in the vibrant atmosphere. Don't miss this opportunity to experience the very best of London and Manchester without breaking the bank.

6 Nights 7 Days London Birmingham and Liverpool Tour Package from UAE

Journey through the heart of England, where history, art, and urban charisma intertwine. Immerse yourself in the iconic splendor of London, revel in the industrial charm of Birmingham, and dance to the rhythm of Liverpool's musical legacy. These 6 nights 7 days London Birmingham and Liverpool tour package from UAE promises an enthralling fusion of culture, heritage, and modernity. Embark on a remarkable adventure that will leave you awestruck by the diversity and grandeur of Britain's majesty. 

5 Days UK Holiday Package

Filled with all kinds of adventure, UK has something for every traveler. Home to some of the most breathtaking places, tourists can explore most in a day or in 2 days, as planned according to their 5-day UK holiday package. Talking about some of the stunning attractions, no vacation in London is complete without going to the tower of London, the National gallery, Westminster Abbey and Windsor Castle. The diversity of UK can’t be described in words, but can only be experienced.

London Delights With Scotland 8 Nights 9 Days Tour Package

The  London delights with Scotland 8 nights 9 days tour package is an exciting way to explore two of the most beautiful destinations in the United Kingdom. It offers a unique blend of culture, history, and natural beauty, which is sure to leave travellers with unforgettable memories. Whether you're a history buff, a nature lover, or a foodie, this tour has something for everyone. 

London York and Manchester 6 Nights 7 Days Tour Package from UAE

Prepare to be captivated as you embark on a remarkable tour through the enchanting cities of London, York, and Manchester. Immerse yourself in the regal splendor of London's iconic landmarks, traverse the cobbled streets of historic York, and experience the vibrant energy of Manchester's cosmopolitan scene with London York and Manchester 6 nights 7 days tour package . With carefully curated activities, cultural explorations, and breathtaking sights, this unforgettable tour package guarantees an immersive and enriching journey through the heart of England.

7 Nights 8 Days London Liverpool and Oxford Tour Package from USA

Embark on an enriching expedition through the iconic cities of London, Liverpool, and Oxford. Unveil England's historical gems, musical heritage, and intellectual prowess during these 7 nights 8 days London Liverpool and Oxford tour package from USA . From the majestic Buckingham Palace in London to the vibrant Beatles history in Liverpool and the scholarly ambiance of Oxford's prestigious university, this tour is a tapestry of England's finest treasures. 

8 Nights 9 Days Magical UK Tour Package

The United Kingdom is a country with a rich history, breathtaking landscapes, and vibrant cities. To experience the best of what this beautiful country has to offer, the  8 nights 9 days magical UK tour package  is the ideal option. From the bustling city of London to the picturesque countryside of Scotland, the UK has something for everyone. The country also offers beautiful national parks, including the Lake District and the Scottish Highlands.

Mesmerizing 5 Nights 6 Days London and Manchester Tour Package from UAE

Embark on an unforgettable journey through the contrasting yet enthralling cities of London and Manchester. Witness the grandeur of London's historical landmarks, revel in Manchester's vibrant culture, and immerse yourself in England's captivating charm. Mesmerizing 5 nights 6 days London and Manchester tour package from UAE promises a mesmerizing experience that will leave you enchanted with the majestic spirit of the United Kingdom. 

Jewels of UK & Scotland 5 Nights 6 Days Tour Package

The Jewels of UK & Scotland tour offers a perfect blend of modern and traditional experiences. Start your journey with a visit to London's iconic landmarks like Buckingham Palace and the London Eye. Head north to the historical city of Edinburgh and explore the medieval Edinburgh Castle and the Royal Mile. Drive through the stunning Scottish Highlands, stopping at Inverness and Loch Ness along the way.

5 Nights 6 Days London York and Manchester Tour Package from UAE

Journey through time and tradition as we take you on an unforgettable expedition to some of England's most captivating cities. Witness the modern vibrancy of London, soak in the historical allure of York, and bask in the spirited atmosphere of Manchester. This 5 nights 6 days London York and Manchester tour package from UAE is designed to immerse you in the essence of English culture, art, and architecture. Join us as we traverse the charming, cobbled streets, discover iconic landmarks, and uncover the hidden gems that make England a treasure trove of experiences. 

London Manchester and Oxford 4 Nights 5 Days Tour Package from UAE

Uncover the beauty and history of three iconic British cities as you embark on an unforgettable journey through the heart of England. Immerse yourself in the vibrant energy of London's bustling streets, explore the industrial charm of Manchester, and bask in the intellectual allure of Oxford. This carefully crafted London Manchester and Oxford 4 nights 5 days tour package from UAE promises a perfect blend of sightseeing, cultural experiences, and leisure, leaving you with memories that will last a lifetime. 

Best of UK 6 Nights 7 Days Tour Package from UAE

For those looking to explore the best of what the UK has to offer, a UK tour is a great way to experience the country's top destinations. Start in London to see iconic landmarks like Buckingham Palace and Tower Bridge. Travel up to Edinburgh for stunning views of the Scottish Highlands and a visit to Edinburgh Castle. Don't forget to stop by the university town of Oxford and the picturesque city of Bath to complete your UK adventure.

5 Nights 6 Days Liverpool and Manchester London Tour Package from UAE

Embark on a captivating adventure through the vibrant cities of Liverpool and Manchester, where rich history, world-class football, and cultural diversity abound. Explore the musical legacy of The Beatles in Liverpool, soak in the energetic atmosphere of Manchester, and indulge in the cosmopolitan charm of London. The 5 nights 6 days Liverpool and Manchester London tour package from UAE promises an unforgettable experience, immersing you in the captivating essence of England. 

Best Selling 7 Nights 8 Days London Couple Tour Package from UAE

Explore the enchanting realms of England and London and dive into the timeless beauty of iconic landmarks, embrace the rich history, and immerse yourselves in the local culture. With meticulously planned itineraries, you'll be delighted by the scenic countryside, vibrant city life, and romantic experiences this journey has to offer. Let us guide you on an unforgettable adventure, where love and adventure intertwine amidst the picturesque landscapes and storied streets with the best selling 7 nights 8 days London couple tour package.

7 Nights 8 Days UK Honeymoon Package

With cinemas, restaurants, parks and clubs, the UK has it all for all the couples who want to explore and begin their new phase of life. You can discover love in either majestic castles or delicate parks. These cities are incredibly scenic and romantic, which will pique your partner's interest in romance with this  7 nights 8 days UK honeymoon package . Travel to Buckingham Palace, Houses of Parliament, Westminster Abbey, Big Ben, Tower of London, Trafalgar Square and Piccadilly Circus with your loved one.

London and Manchester 3 Nights 4 Days Honeymoon Package from UAE

Discover romance amidst the timeless charm of London with our London and Manchester 3 nights 4 days honeymoon package from UAE . Experience the perfect blend of urban excitement and warm hospitality as you venture into the vibrant streets of Manchester. Unravel the beauty of renowned landmarks, indulge in delightful culinary experiences, and create lasting memories on this enchanting journey through London, where love knows no bounds. 

2 Nights 3 Days England Honeymoon Package

If you're planning a romantic getaway to England, this  2 nights 3 days England honeymoon package offers the perfect mix of adventure and relaxation. With a visit to the iconic Madame Tussauds Museum and a Thames cruise, you'll experience London's vibrant culture and history while creating unforgettable memories with your loved one.

Best Selling 3 Nights 4 Days London and Manchester Leisure Tour Package from UAE

Uncover the essence of two captivating cities, London and Manchester, in our bestselling 3 nights 4 days London and Manchester leisure tour package from UAE. Over 3 nights and 4 days, immerse yourself in the rich history, cultural diversity, and vibrant urban energy of these iconic destinations. From London's regal landmarks to Manchester's music and arts scene, this tour promises an unforgettable journey that will leave you inspired and enchanted. 

6 Nights 7 Days London & Edinburgh Honeymoon Package

Embark on a romantic journey to the two beautiful cities of London and Edinburgh with our  6 nights 7 days London & Edinburgh honeymoon package. Explore the iconic landmarks of London, such as the London Eye, Big Ben, Buckingham Palace, and more. In Edinburgh, visit Edinburgh Castle, Royal Botanic Garden, and other breathtaking attractions. Enjoy your honeymoon in the most romantic way!

Exciting 5 Days 4 Nights Manchester and London Honeymoon Package from UAE

Are you ready to embark on an enchanting journey through two of England's most vibrant and culturally rich cities? Look no further than our exciting 5 days 4 nights Manchester and London honeymoon package from UAE . Let the magic of these iconic cities sweep you off your feet as you indulge in each other's company and create cherished memories that will last a lifetime. From the buzzing streets of Manchester, brimming with artistic charm, to the majestic landmarks of London, where history and modernity collide, this honeymoon adventure promises to ignite the spark of love and fascination.  

The historical and cultural holiday destination, UK is always flooded with tourists throughout the year. Known for its Scottish landscapes, British royal family, the Beatles and several castles and forts, United Kingdom is one of the most stunning places to explore. One can take the train to Oxford to discover its history and tradition or simply see a concert on the streets of London. So, are you keen on visiting UK? Check out the UK holiday packages for your needs.

Best Time To Visit: Late March- Early June

Major Airports: London Heathrow, London Gatwick, London Luton

Top Things to Do and See on Holiday in the UK from UAE

The UK is brimmed with stunning things to do and explore on your holiday in this majestic destination. One can witness its enchanting beauty and experience every fun with the United Kingdom tour package for a memorable vacation.

1. London - Tour Of The City

When visiting England, it is impossible not to spend time in its Capital, London. One of the ideal ways of getting your bearings is to hop on to a double-decker bus or take a black cab, that will take you to the tower of London and Buckingham Palace. With the incredible architecture and happening vibe, London tour package is the best holiday plan you can think of, for spending the best time in the UK.

2. York- Clambering Up The City Walls

The old charming old city discovered by the Romans, is nestled at the top end of the country in North Yorkshire. One of the many thing's tourists will find impressive is the medieval architecture. Tourists when visiting York should clamber up the city walls. Explore the classical charm of the beautiful destination with the best UK travel package and get a glimpse of the astounding architecture.

3. Oxford- Discovering The History

Planning to visit Oxford? Enjoy the train ride to Oxford university. Discover its history seen in its medieval-era buildings along with Carfax towers. Tourists can enjoy the stunning view of the city and visit the bridge of sighs in Hertford college. Get a sneak peek of the holiday packages and plan your vacation accordingly.

4. Durham- Tucking into Fine Cuisine and Shopping

A delightful place to discover, Durham has over 600 UNESCO designated buildings. Durham cathedral and Durham castle are two of the major attractions in the city. Durham is an ideal place to shop and eat at restaurants to pleasant teashops. Enjoy exploring the magnificent charm of the ancient wonders and savor flavorsome cuisines to enhance your taste with the United Kingdom holiday package from the UAE .

5. Salisbury- Exploring the Old Streets and Architecture

 The cathedral city, Salisbury should be added on your bucket list of places to explore. The city is home to a precious historic document Magna carta, that draws up a charter of rights of the people of England. People can visit the old streets and architecture surrounding of the cathedral. Get a chance to discover the majestic grandeur of the city with the UK trip package from the UAE .

Travel Tips For United Kingdom Holiday - 

• Check your visa and passport needs  
• Know your travel options  
• Check on your healthcare options  
• Be ready for all kinds of weather  
• Carry the right currency

United Kingdom Tour Packages from UAE FAQs

We have a team of some of the best agents in the world who can handle every need or demand customers have.

We believe in offering superior quality and nothing less.

We believe in 100% customer satisfaction. We are available 24 hours a day to solve all kinds of problems.

United Kingdom Tour Packages By Theme

• United Kingdom Family Packages

UK Family Packages from UAE

The United Kingdom (UK) has long been one of Europe's most popular tourist destinations, consisting of Scotland, England, Northern Ireland and Wales in family holiday deals with the UK . The country's varied landscape and rich cultural heritage contribute significantly to its appeal. From beautifully preserved country estates and castles to its many world-class art galleries and museums, the best places to visit are plentiful in luxury family holidays in the UK . The United Kingdom, as one of the world's most dominant nations, is overwhelmed with visitors all year. Scottish scenery, the British royal family, the Beatles, and several castles and forts make the country a cultural and historical destination. Attend a concert on London's streets or simply take a train to university towns such as Oxford to learn about their culture and traditions.

However, one of the most enjoyable aspects of a family adventure holiday in the UK is how simple it is to travel around this fascinating and diverse country.

Places to visit on your family holidays uk

While the United Kingdom has hundreds of places to visit, a few stand out and listed below:

The United Kingdom without visiting London is not recommended, as the country's sprawling capital has plenty of attractions to keep you occupied. One of the top things to do in London for those interested in learning more about the United Kingdom's rich past is to visit the Tower of London during family adventure holidays in the UK .

Edinburgh is well known as the home of the magnificent Edinburgh Castle, which is famous for its many well-preserved historic buildings and included in fun family holidays in the UK .

Many visitors planning to visit northern England, Scotland, or Wales begin their journey in Manchester. Castlefield is known for its well-preserved Victorian buildings, canals, and Roman ruins, as well as the numerous old warehouses that have been converted into trendy stores, hotels, and restaurants which are must-visit destinations in family adventure holidays in the UK .

Although legendary monster legends have largely been debunked, the spectacular Loch Ness remains a popular tourist destination for visitors to Scotland.

The historical town of Windsor is conveniently located west of London on a short train ride and offers many attractions. It's home to magnificent Windsor Castle, the most popular of the UK's royal castles, as well as a lovely Thames-side setting and many mediaeval half-timbered buildings along its charming old cobblestone laneways.

Things to do in family holiday breaks uk

Wales adventures.

The blustered coast of Pembrokeshire National Park is accessible by train and coastal bus. It is also a safe place where children can practise a range of adventure sports including kayaking, coast sports, surfing and walking.

Scottish Winter Walking

Take the train to the Scottish Highland, with an experienced Mountain Guide, for a week of challenging winter walks.

Lake District family activities holiday

The Lake District is one of the most attractive places in the United Kingdom. Abseiling and climbing, or you can take local walking trails alone at your own steam are all possible.

Horse Riding

The trail will be led by an experienced local guide and a small group of passengers, with nights spent in small inns and guesthouses along the way is the best family getaway.

English Channel Sailing

Sailing the English Channel from England to France offers adventure, shifting scenery, and the opportunity to see some of the French coastline and the Channel Islands without having to fly. This sailing vacation is suitable for beginners, and you will learn all of the required skills, exercises, and manoeuvres while on the water in the family adventure holidays in the UK.

Best time to visit the UK with family

The United Kingdom can be visited at any time of year because its climate is mild and does not suffer extremes during summer or winter. The best times to visit are in the spring (late March to early June) and fall (September to November), when the weather is usually mild and dry.

How to Reach UK

England has numerous airports that link the country to major cities around the world, as it is a major tourism and business hub. Heathrow Airport, the largest in the United Kingdom, is also the world's third busiest. Manchester's airports link the country's northern regions. All of the major airline companies fly to England, with British Airways being the most well-known.

Book Family Adventure Holidays UK at Pickyourtrail

The United Kingdom is a historical English empire made up of four countries. When it comes to cultural landmarks, what you will see here in England with family holidays in the UK are cultural landmarks that have remained unchanged over time while still being advanced in growth. You will discover architecture wrapped in the essence of theatre and Roman heritage on Pickyourtrail best UK holidays for families, bringing the notion of time immortality to life. A sightseeing tour of the United Kingdom will give you a taste of the country's heritage as well as its modernity.

Pickyourtrail identifies the region's distinct potential and incorporates complex itineraries into family holidays in the UK.

Edinburgh (3N)

Inverness (2N)

• Loch Ness, Glencoe and the Highlands Small-Group Day Tour from Edinburgh

London (4N)

Windermere (2N)

• London Eye River Cruise and Standard London Eye Ticket

London (3N)

• Windsor Castle Half Day Trip from London

Windermere (3N)

London (5N)

Glasgow (2N)

• Visit Trafalgar Square
• Shakespeare's Globe Theatre Tour with Thames River Cruise in London

London (6N)

• Combo Ticket: London Eye- SEA LIFE London -Madame Tussauds London

Barcelona (3N)

• River Seine Sightseeing Cruise
• Warner Bros. Studio: The Making of Harry Potter with Luxury Round-Trip Transport from London
• City Sightseeing Paris Hop-On Hop-Off Tour

Edinburgh (4N)

• Fast-Track Admission to Edinburgh Castle

London (1N)

Inverness (3N)

• Caledonian Canal,Loch Ness Sightseeing Cruise and Urquhart Castle
• London Tour with Admission to Madame Tussauds & London Eye

Glasgow (3N)

• Best of London with London Eye

• Family Packages

International Tour Packages From Dubai

Honeymoon packages.

Exclusive Eid al Adha Deals are live! Pre-book now at AED 2899

•  Download Mobile App
•  Login/Sign-up
•   Contact Us
• Edit Profile
• Get Mobile Application
• AED AED USD EUR GBP INR AUD MYR OMR SAR SGD THB ZAR
• {{ct.ServiceName}} {{options.OptionName}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C | {{options.TravelDate}} | {{options.TransferName}} {{options.OptionName}} {{options.NoOfQuantity}} x {{options.Type}} {{options.OptionName}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C | {{options.TravelDate}} | {{options.MealName}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C | {{options.TravelDate}} {{options.OptionName}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C,{{options.NoOfInfant}}I | {{options.TravelDate}} {{options.OptionName}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C | {{options.TravelDate}} {{options.RoomTypeName}} - {{options.MealName}} {{options.CheckInDate}} - {{options.CheckOutDate}} {{options.NoOfAdult}}A,{{options.NoOfChild}}C | No. of Room: {{options.NoOfRoom}} AED {{parseDecimal2(ct.Price)}} Remove
• Cart is Empty.

Total AED {{parseDecimal2(Price)}}

Login to Your Account

Submit details to get a call back.

• Home  / 
• Holiday  / 

LONDON CITY BREAK

3 Nights & 4 Days

Transfer included, hotel included, flights included, non refundable, check availability.

Select Date

Select Month

Select day ({{sn.selectedmonth}}) < back to month.

Package date

Rooms & Passengers

Passengers (Room {{$index+1}})

1">room {{$index+1}}, oops options not available for selected occupancy..

Try using another occupancy or check another Package.

Arrive in London, the Capital of England

London, England’s capital, set on the river Thames, is a 21st-century city with a history stretching back to Roman times. At its center stand the imposing Houses of Parliament, the iconic ‘Big Ben’ clock tower, and Westminster Abbey, the site of British monarch coronations. Upon your arrival at the airport/train station, you will have a private vehicle to transport you to the hotel. (Standard check-in time would be approx. 14:00 – 15:00 hrs. depending on the hotel). Check-in and the rest of the day is free for leisure and relaxing activities

London: Hop on Hop Off Bus Tour

• Experience London from the top of an open-topped bus
• Hop on and hop off at any of our carefully chosen stops 
• See the best of London and create memories that will last a lifetime 

London: (Choose one of the Optional Activities )

Depart london.

• Daily Breakfast at the Hotel 
• London Hop on Hop Off Bus Tour (24 Hr. Ticket)
• Arrival airport transfers from London (LHR) Airport to London Hotel Departure airport transfers from London Hotel to London Airport (LHR) 
• Optional Sightseeing: You can Choose any one activity (Note: The tour starts from a city center point, transportation to & from the hotel is not included) 
• UK Tourist Visa fee (if applies)
• Any Flights -Travel Insurance & local Tourism fee if applicable
• Optional activities entry Tickets
• Tipping - an entirely personal gesture
• Any High Peak Season or Events Surcharge (if any) 

Important Terms & Conditions :

• Prices are subject to availability and are subject to change.
• Rates are not valid during seasons or events, some Surcharge may apply
• Tourism Fee, Resort fee, or City Tax Directly Payable at the Hotel by the passengers (If Applicable)

London (3 N)

+971 56 507 1346, cancellation policy, latest travel update.

Shopping in Dubai 2024: 10 Best Shopping Malls in Dubai for Shopaholics

Are you addicted to shopping and want to buy new and exciting things?  Yes, then Dubai has the topmost shopping malls to make your journey more entertaining. 

Persian Food Dubai - Top 5 Iranian Restaurants in Dubai 2024

What about getting delicious Persian food with the best quality and hygiene? Sounds flavorful, right? So, there are the top 5 Persian food restaurants to give you a delightful taste.

Mother's Day in Dubai 2024: Pamper your Mum with Your Love

Ditch the flowers, and get ready to celebrate Mom in style.  Look no further than Dubai!  This blog is your guide to creating a Mother's Day experience as amazing as she is.

10 Nearby Visa Free Countries for UAE Residents 2024

Looking for some visa-free countries to visit during the long weekend? This blog contains some famous destinations you can choose from!

Plan your Next Holidays

Request for call back. know more about the latest travel trends & deals.

• Democratic Republic of the Congo
• Guinea-Bissau
• Ivory Coast
• Saudi Arabia
• South Africa
• South Sudan
• United Arab Emirates
• United Kingdom
• United States
• UK Packages

Best Of Great Britain

Amazing United Kingdom, Scotland and Ireland Combo Tour

Launching Soon

• Cherry Blossom Special
• National Day & Christmas Holidays
• Christmas Special
• EID Holidays

London, Scotland & Ireland - Summer

Best Holiday Packages from Dubai & Abu Dhabi

• Terms & Conditions

INTRODUCTION

Enjoy Panoramic view of London city from London Eye, visit Royal residence - Windsor Castle, Free time for ultimate shopping experience on Oxford Street. Stroll through its famous historic downtown area and castle in Edinburgh. View Magnificent scenery, lakes, Mountains in Scottish Highlands, Enjoy Sites and Locations of World-famous Television Series “Game of Thrones” in Ireland with tour of TravTips, London, Scotland & Ireland.

PACKAGE HIGHLIGHTS

• Enjoy Panoramic view of London City from London Eye
• Visit the famous Windsor Castle - Queen of England’s favourite weekend home
• Memorable selfie with Stars in Madame Tussauds
• See the English capital’s top landmarks with English speaking tour guide - Changing of Guards at the Buckingham Palace, Hyde Park, Big Ben and Many More!
• Free time for shopping on Oxford Street - Europe's busiest shopping street
• Visit to Cadbury World, discover the making and magic behind the Cadbury brand
• See Imposing Edinburgh Castle
• View Magnificent scenery, lakes, Mountains in Scottish Highlands
• Visit the Titanic Belfast, exploring the Titanic story in a fresh and insightful way
• Visit locations of the world famous Television Series
• Make cherishable memories in England, Scotland & Ireland
• Quality hotel with well-appointed facilities
• Transportation, Accommodation & Meals
• Convenience of the round trip airfare
• Itinerary crafted by tourism industry experts
• Impeccable safety standards
• Great value for Money holiday
• Top-Class services and Integrity at every level

UNIQUE FEATURES

• Award Winning Flights
• Quality Hotel Accommodation
• Daily Breakfast
• 09 Indian Dinners
• Visit to London Eye Europe’s Largest Observation Wheel
• Visit to Windsor Castle
• Chance to Visit Madame Tussauds Wax Museum
• Guided City of London
• Visit to Tower of London
• Free Time at Oxford Street
• Enjoy Visit to Cadbury World
• Entrance to Manchester City Stadium
• Scenic Cruise of Lake Windermere
• Visit Gretna Green
• Visit to Whiskey Distillery
• Guided City Tour of Edinburgh
• Entrance to Edinburgh Castle
• Ferry from Cairnryan to Belfast
• Visit to Titanic Exhibition
• Full day tour of One of the World
• Famous Television Series
• Entrance to Winterfell Castle
• Guided City Tour of Dublin
• Entrance to Guinness Storehouse

TENTATIVE ITINERARY

   + day 1: arrive london (dinner).

Welcome to London. London Eye. Bon voyage! Arrive in London, you will be greeted by your friendly Tour Manager outside the baggage hall. Proceed to hotel & check in. Later we take you on the famous London Eye – one of the Europe’s largest observation wheels where you witness the panorama of some of London’s most famous monuments. Followed by Indian Dinner at Restaurant. Overnight in London Heathrow

    + Day 2: London (Breakfast & Dinner)

Windsor Castle. Madame Tussauds wax Museum. After continental buffet breakfast, we then take you to visit the famous Windsor Castle - Queen of England’s favorite weekend home. Be enthralled by this thousand year old fortress transformed into a royal palace. We proceed for a visit the famous Madame Tussauds wax museum. This museum houses a unique collection of world’s largest wax works of famous personalities, including India’s top leaders and film stars. Tonight, enjoy Indian Dinner at Restaurant. Overnight in London Heathrow

   + Day 3: London (Breakfast & Dinner)

Guided city tour. Tower of London. Free time at Oxford Street. After continental buffet breakfast, we proceed for a guided city tour with an English Speaking local guide to see the highlights of London: Changing of Guards at the Buckingham Palace, Hyde Park, Big Ben, Westminster Abbey, Houses of Parliament, Trafalgar Square, Tower Bridge, River Thames and many more. We next visit the Tower of London housing Britain’s crown jewels including the Kohinoor Diamond. Later enjoy free time for shopping on Oxford Street - Europe's busiest shopping street , with around half a million daily visitors. Indian Dinner at Restaurant. Overnight in London Heathrow.

   + Day 4: London – Manchester (Breakfast & Dinner)

Bicester Village. Cadbury World (Subject to availability) After continental buffet breakfast, check-out and proceed to Bicester Village , Bicester Village is home to more than 160 boutiques from the world's leading designers. The Collection is unique in its unprecedented brand mix, beautiful settings, cultural richness, and remarkable service and savings. Visit to Cadbury World , discover the making and magic behind the Cadbury brand in our series of chocolatey zones. Enjoy a sequence of special effects cinema presentations in themed auditoriums. See how Cadbury's most popular products were made at interactive video stations, watch Chocolatier's demonstrate traditional chocolate making skills, plus indulge in a warm pot of melted chocolate. You will also be able to reminisce over Cadbury adverts from the past 100 years. This evening after Indian Dinner at Restaurant & check into your hotel. Overnight in Manchester.

   + Day 5:Manchester – Lake District (Breakfast & Dinner)

Manchester City (Subject to availability). Lake Windermere Cruise. After continental buffet breakfast, check-out and proceed to visit the famous Manchester City Stadium with an immersive 360 cinema film vividly bringing to life the 125-year history of the club. Once in the stadium, you will visit the changing rooms, player’s tunnel, pitch side and press conference areas, visit the home changing room, sit in the dug-out & run down the tunnel to the roar of the crowd. Later drive through England’s first ever National Park known as the Lake District, a mountainous region dotted with lakes, truly an inspiration for many writers including William Wordsworth. Enjoy scenic cruise on Lake Windermere . This evening after Indian Dinner at Restaurant & check in to your hotel. Overnight in Gretna / Lancaster.

   + Day 6: Lake District – Edinburgh/Glasgow (Breakfast & Dinner)

Gretna Green. Guided City Tour of Edinburgh & Entrance to Edinburgh Castle. After continental buffet breakfast, we check-out and proceed to Gretna Green - one of the world’s most popular runaway wedding destinations. Later proceed to Edinburgh, enroute we will visit Whiskey Distillery, enjoy a guided tour at our beautiful distillery, taking in the fascinating past with a glimpse into our future. Learn about unique distillation process, and be among the first to taste our Man O' Words and Man O' Sword - our Single Cask, Single Malt Scotch whiskies - together with our exceptional Clear Malt Spirit, Rascally Liquor®. On Arrival in Edinburgh, meet your local guide for a city tour of Edinburgh who will tell you about the history and culture of this city. See the Scottish Parliament & Entrance to imposing Edinburgh Castle with its breath-taking views over the city. Edinburgh Castle is alive with exciting tales of its time as a military fortress, royal residence and prison of war. When you climb Castle Hill, you will walk in the footsteps of soldiers, kings and queens – and even the odd pirate or two. Though parts of it remain in military use, the castle is now a world-famous visitor attraction. It’s also an iconic part of the Old and New Towns of Edinburgh World Heritage Site. Indian Dinner at Restaurant. Overnight in Edinburgh/Glasgow

   + Day 7: Glasgow – Belfast (Breakfast & Dinner)

Visit Titanic Exhibition. After continental buffet breakfast, proceed to the Cairnryan Ferry Port to take a ferry to Belfast. Visit the Titanic Exhibition, Titanic Belfast is the world's largest Titanic visitor experience , exploring the Titanic story in a fresh and insightful way. Indian Dinner at Restaurant. Overnight in Belfast.

   + Day 8: Belfast (Breakfast & Dinner)

Visit the Dark Hedges. Dunluce Castle. Giant’s Causeway. After continental buffet breakfast, today enjoy a full day tour of the sites and locations of the world famous Television Series. Visit the Dark Hedges , these trees are in an amazing formation and are well worth a photograph. No tours in Northern Ireland will be complete without seeing this avenue of trees known to series fans as the Kings Road. Next visit the Downhill beach . Later proceed to Coleraine for some free time. Next, a photo stop at Dunluce castle which is depicted as Castle Greyjoy. Next, visit the Giant’s Causeway which is a UNESCO world heritage site and a magnificent wonder. These Hexagonal rocks were formed by volcanic eruptions over 50 million years ago; the lava cooled rapidly forming over 40,000 interlocking basalt columns. Indian Dinner at Restaurant. Overnight in Belfast.

   + Day 9: Belfast – Dublin (Breakfast & Dinner)

Visit Winterfell Castle. Guinness Storehouse Brewery. Visit the Winterfell Castle, another site of the world famous TV series. Next, drive to Dublin for a guided sightseeing tour of Dublin including entrance to Guinness Storehouse Brewery tour. Indian Dinner at Restaurant. Overnight in Dublin

   + Day 10: Depart Dublin (Breakfast)

Fly back home with pleasant memories. After a continental buffet breakfast, check out and proceed to the airport for your flight back home. Do spare a few minutes to share your feedback with your Tour Manager. Your valued suggestions will be most appreciated. Arrive home with pleasant memories of your European tour, which we are sure you will treasure for a lifetime.

• Award Winning Flights (Return economy class airfare with airport taxes) on Turkish Airlines (Ex – Dubai) or Similar
• 03 nights accommodation at DoubleTree by Hilton / Hilton Garden Inn Heathrow - 4*or Similar at London
• 01 night accommodation at Leonardo Manchester – 4* or Similar in Manchester
• 01 night accommodation at Gretna Hall – 3* or Similar in Gretna
• 01 night accommodation at Hilton Garden Inn / DoubleTree by Hilton Westerwood 4* or Similar in Glasgow
• 02 nights accommodation at Clayton Hotel Belfast / Holiday Inn Belfast 4* or Similar in Belfast
• 01 night accommodation at Carlton Blanchardstown 4* or Similar in Dublin
• Daily breakfast
• 09 Indian Dinners (Choice of Jain/Vegetarian/Non- Vegetarian/Halal)
• Guided city tour
• Entrance to Madame Tussauds wax museum
• Ride on the London Eye
• Visit Windsor Castle
• Visit Cadbury World
• Manchester City Stadium / Old Trafford Stadium
• Windermere Lake Cruise
• Guided Edinburgh City tour
• Visit Scotch Whisky Experience
• Full day tour of one of the world famous Television Series
• Guided city tour of Dublin
• UK Visa Charges
• Travel Insurance
• No porterage included
• Mandatory Tips to coach drivers / local guides to be paid directly to tour manager (3 GBP’s per person - per day)
• Taxes as applicable
• Any expenses of personal nature such as porterage, laundry expenses, wines, mineral water, food and drink not in the regular menu provided by us, minibar, telephone calls etc.
• Meals other than that what is mentioned in your itinerary
• Cost of excursions, city sightseeing, entrance fees and local guides availed of by the passengers, other than that mentioned in “What your tour price includes”

PACKAGE COST

Mea appareat omittantur eloquentiam ad, nam ei quas oportere democritum . Prima causae admodum id est, ei timeam inimicus sed. Sit an meis aliquam, cetero inermis vel ut. An sit illum euismod facilisis, tamquam vulputate pertinacia eum at.

Mandatory EXCURSION

Mt. Titlis with Ice Flyer at AED 500 per adult & AED 400 per child

• Cash Discount *
• Free Visit to Madame Tussauds Wax Museum

DEPARTURE DATES 2024:

06 Apr 15 Jun 29 Jun 30 Jun 06 Jul 07 Jul 13 Jul 20 Jul 03 Aug 10 Aug

    1· What is Included in an All Inclusive UK & Ireland tour from Dubai with TravTips?

Our all-inclusive tour package from Dubai typically includes:

• Round-trip flights from UAE
• Accommodation in Quality hotels
• Daily Breakfast and Indian Dinners
• Ground transportation between destinations through long-distance air-conditioned coach
• Must see sightseeing with entry tickets
• Dedicated Indian Tour Manager

    2. What cities we cover in London, Scotland & Ireland All Inclusive Europe tour from Dubai?

In this holiday package from Dubai, we cover London, Birmingham, Manchester, Lake District, Edinburgh, Glasgow, Belfast, and Dublin

   3. What time of year is the best time to visit Europe?

The best time to visit Europe depends on your preferences. The spring and fall shoulder seasons (March & April) offer pleasant weather and fewer crowds. Summer (June-August) is peak season, with warm weather and lively festivals. Winter (November-December) is a great time to visit for Christmas markets and cozy getaways.

   4. Do I need a visa to travel to United Kingdom & Ireland?

Visa requirements vary depending on your nationality and the countries you plan to visit. For this tour from Dubai we have to get UK & Ireland Visa from their respective Embassies.

   5. What should I pack for my All Inclusive Europe tour?

Carry Warm clothing like sweaters, woolen jackets are essential. You must carry a cap, sunglasses, a folding umbrella and comfortable walking shoes (Canvas or track shoes). Avoid high heel shoes.

   6. What currency should I carry for London, Scotland & Ireland Tour from Dubai?

It’s possible to use GBP in Great Britain and Northern Ireland, however in Southern Ireland (Dublin) EUR currency is accepted. Hence, you'll need both euros and pounds.

   7. How can I stay connected while I'm in Europe?

Both Du & Etisalat offers international roaming plans. You can also purchase a local SIM card when you arrive in the Airport.

   8. What is the Baggage Policy?

• Turkish Airlines allow a maximum 1 piece of 30 Kgs per person and 01 piece of cabin baggage weighing not more than 07 Kgs per person.
• Qatar Airways allow a maximum 1 piece of 25 Kgs per person and 01 piece of cabin baggage weighing not more than 07 Kgs per person.
• Swiss International Airlines/ Lufthansa allow a maximum of 23 Kgs per person and 01 piece of cabin baggage weighing not more than 07 Kgs per person. An item of baggage must not exceed 158 cm in size (width + height + depth).

   9. Is All Inclusive Tour Itineraries Suitable for a family to travel in an All Inclusive Group tour from Dubai?

Our All Inclusive tour from Dubai is crafted Specially for the Indian & South Asian Families.

• Convenience: All Inclusive tours are very convenient for families, as everything is taken care of for you, from transportation and accommodation to meals and activities. This can take a lot of stress out of planning and traveling with kids.
• Activities for everyone: Most All Inclusive tours offer a variety of activities and excursions, so there's something to keep everyone in the family entertained. This can be a great way to explore new places and try new things.
• Safety and security: Group tours can provide a sense of safety and security, especially if you're traveling to a new country or region for the first time.
• Value for money: All Inclusive tours can be a good value for money, as they cover most of end-to-end service for your trip in one price.

PAYMENT TERMS

Cancellation policy, terms & conditions:.

• Package is valid for specific dates (*Supplement may apply for peak dates).
• COVID Restrictions & PCR Guidelines might change anytime without any notice.
• Above is only a quotation. No reservations are being held.
• All rates and confirmations are subject to availability at the time of booking.
• Special requests are subject to availability at the time of Check in.
• Standard hotel check-in time 1400hrs & check-out time 1100hrs local time. It may vary based on destinations & availability.
• Bookings will be confirmed as per payment policy.
• The itinerary is just indicative & might change due to unforeseen situations.
• The tour will be operated subject to a minimum of 20 full paying passengers travelling together.
• In the event that the group size is less than 20 passengers you will be given an option of travelling on another departure date.
• Breakfast will be continental which includes tea, coffee, cereal, juice, bread, butter.
• Dinners are preset and A-la carte is not possible.
• The availability of adjoining rooms / interconnecting rooms / non-smoking rooms / rooms on the same floor etc. cannot be guaranteed.
• Room Type (Double or Twin) is subject to availability & is at sole discretion of the hotel.
• In case of currency fluctuations of more than 3.00% or amendments in local Government taxes, we reserve the right to advice you a supplement cost.
• Prices are dynamic & based on offers running at the time of booking. We reserve the right to change price anytime.
• TravTips will not be liable for the same.
• The company shall not accept any liability or responsibility for any damages, loss, baggage loss, injury, accident, death, breakdown or irregularity, which may occur in carrying out the tour arrangement, weather conditions, strikes, war, quarantine and any other cause whatsoever and all such loss or expense must be borne by the passengers. Insurance policies must be carried while on tour.
• The management reserves the right to claim any additional expenses incurred due to delay or changes in schedules of train, aero plane, bus, ship or other services.
• Due to private coaches being forbidden inside the city’s most of your sightseeing will be done by local buses and by foot. The tour manager and the driver will do their best to get you as close to the monuments as possible.
• We also reserve the right to substitute a hotel of similar class if it is deemed advisable or necessary.
• Prices are based on 4 star non-central hotels. We do not guarantee air-conditioned hotels.
• The Passport must be valid for 6 months from the date of return.
• As a 3rd person in a triple room, most hotels use rollaway beds and room size may be the same as the double room.
• We reserve the right to amend, alter, vary or withdraw any particular departure, excursion advertised.
• For the convenience of our passengers, we will sometimes amend the itinerary.
• A local representative or a driver may only be there to assist you during your initial part of the tour.
• Taxes shall be applicable (If any) by UAE government.
• Security alerts and random closures might affect the itinerary.
• Passenger are solely responsible for meeting the passport & visa conditions of the country of travel.
• There are no refunds for any services i.e. meals, sightseeing etc. not utilized during the tour.
• We do not accept any responsibility if the passenger cannot travel because of any passport/ visa issue / medical & health conditions, cancellation policy will be applicable as per the booking terms.
• Rates are in AED based on current rate of exchange. Rates are subject to change without prior notice or due to events beyond our control.
• Rates are not valid during Peak dates.
• Please check the visas requirements for the countries visiting.
• Please check the names given as per the passports to avoid inconvenience/offloading.

London, Scotland & Ireland - Spring

Accommodation.

• 03 nights accommodation at Holiday Inn Bath Road - 4*or Similar at London
• 01 night accommodation at AC Manchester Salford Quays – 4* or Similar in Mancheste
• 01 night accommodation at Courtyard by Marriott Glasgow SEC 4* or Similar in Glasgow
• 02 nights accommodation at Holiday Inn Belfast 4* or Similar in Belfast
• 01 night accommodation at City North / Plaza Tallaght / Carlton Blanchardstown 4* or Similar in Dublin

SIGHTSEEINGS

United kingdom.

• Free time at Oxford Street
• Full day tour of one of the World Famous Television Series
• PCR Test in UAE
• PCR Test in Local destination (Approx. EUR 60 – EUR 90 per person)
• Tips to coach drivers / local guides to be paid directly to tour manager (3 GBP’s per person per day)
• Cash Discount*
• Free Visit to Madame Tussauds wax museum

DEPARTURE DATES 2023:

• May 2020: 22
• July 2020: 31
• Travelling from UAE to United Kingdom, COVID-19 entry regulations lifted on 17 March 2022.
• Travelling from Ireland to UAE, COVID-19 entry regulations lifted on 9 November 2022.
• In case the selected hotel is not available for booking, an alternate arrangement will be offered to the customer in a hotel of a similar category.
• Any damages caused to the hotel rooms / Coach during your stay, shall be payable by the passengers. TravTips will not be liable for the same.
• The Passport must be valid for 6 month from the date of return.
• For the convenience of our passengers, we will sometimes amend the itinerary. However, all the services will remain the same.
• Rates are in AED based on current rate of exchange.Rates are subject to change without prior notice or due to events beyond our control.
• In case any member of the group tests positive for COVID-19, customers will need to unconditionally abide, adhere and comply solely at your costs and expenses to all laws, rules, notifications, Travel advisories, guidelines, directives and communications issued from time to time by all or any Governments, Authorities, Ministries, Departments, Local Bodies in UAE or Abroad, related to your tour to the foreign destination and/or on your return from the tour to your home destination in UAE or Abroad including but not limited to Covid-19 Protocols on quarantine, vaccinations etc. or in connection with any other Pandemic, epidemic, disease, condition etc., which may be communicated by all or any Governments, Authorities, Ministries, Departments, Local Bodies in UAE or Abroad with or without notice at any point of time whether at the commencement of the tour, during the tour and/or on the completion of the tour, as the case may be.

COVID-19 SAFETY GUIDELINES

• Maintain at least three feet distance from the next traveler.
• Wash your hands frequently for about 20 seconds. We recommend frequent washing every 30 minutes.
• Most airlines prefer web check-in for your safety.
• Always wear a mask and carry sanitizers, gloves, and soap gel for frequent hand washing.
• Avoid crowding, especially in the aircraft.
• Follow all health advisories and travel guidelines of the country of travel.
• Be sure to have taken all vaccinations that are essential to protect your immune system.
• Always cough into your elbow and wear a mask.
• Arrive early at the airport to follow security protocol.
• Carry travel insurance for your emergency needs.
• Immediately report any symptoms of fever, cough, and breathlessness (if you have any) to the nearest medical authority.

London, Scotland & Ireland - Winter

Departure dates 2023/24:.

23 Mar & 30 Mar

London, Scotland & Ireland - National Day

• Full day tour of One of the World Famous Television Series

Windsor Castle. Madame Tussauds wax Museum. After continental buffet breakfast, we then take you to visit the famous Windsor Castle - Queen of England’s favorite weekend home. Be enthralled by this thousand year old fortress transformed into a royal palace. We proceed for a visit the famous Madame Tussauds wax museum . This museum houses a unique collection of world’s largest wax works of famous personalities, including India’s top leaders and film stars. Tonight, enjoy Indian Dinner at Restaurant. Overnight in London Heathrow.

   + Day 5: Manchester – Lake District (Breakfast & Dinner)

Gretna Green. Guided City Tour of Edinburgh & Entrance to Edinburgh Castle. After continental buffet breakfast, we check-out and proceed to Gretna Green - one of the world’s most popular runaway wedding destinations . Later proceed to Edinburgh, enroute we will visit Whiskey Distillery , enjoy a guided tour at our beautiful distillery, taking in the fascinating past with a glimpse into our future. Learn about unique distillation process, and be among the first to taste our Man O' Words and Man O' Sword - our Single Cask, Single Malt Scotch whiskies - together with our exceptional Clear Malt Spirit, Rascally Liquor®. On Arrival in Edinburgh, meet your local guide for a city tour of Edinburgh who will tell you about the history and culture of this city. See the Scottish Parliament & Entrance to imposing Edinburgh Castle with its breath-taking views over the city. Edinburgh Castle is alive with exciting tales of its time as a military fortress, royal residence and prison of war. When you climb Castle Hill, you will walk in the footsteps of soldiers, kings and queens – and even the odd pirate or two. Though parts of it remain in military use, the castle is now a world-famous visitor attraction. It’s also an iconic part of the Old and New Towns of Edinburgh World Heritage Site. Indian Dinner at Restaurant. Overnight in Edinburgh/Glasgow

Visit Titanic Exhibition. After continental buffet breakfast, proceed to the Cairnryan Ferry Port to take a ferry to Belfast. Visit the Titanic Exhibition, Titanic Belfast is the world's largest Titanic visitor experience, exploring the Titanic story in a fresh and insightful way. Indian Dinner at Restaurant. Overnight in Belfast.

Visit the Dark Hedges. Dunluce Castle. Giant’s Causeway. After continental buffet breakfast, today enjoy a full day tour of the sites and locations of the world famous Television Series . Visit the Dark Hedges , these trees are in an amazing formation and are well worth a photograph. No tours in Northern Ireland will be complete without seeing this avenue of trees known to series fans as the Kings Road. Next visit the Downhill beach . Later proceed to Coleraine for some free time. Next, a photo stop at Dunluce castle which is depicted as Castle Greyjoy. Next, visit the Giant’s Causeway which is a UNESCO world heritage site and a magnificent wonder. These Hexagonal rocks were formed by volcanic eruptions over 50 million years ago; the lava cooled rapidly forming over 40,000 interlocking basalt columns. Indian Dinner at Restaurant. Overnight in Belfast.

Visit Winterfell Castle. Guinness Storehouse Brewery. Visit the Winterfell Castle , another site of the world famous TV series. Next, drive to Dublin for a guided sightseeing tour of Dublin including entrance to Guinness Storehouse Brewery tour . Indian Dinner at Restaurant. Overnight in Dublin.

• 03 nights accommodation at Radisson London Heathrow - 4*or Similar at London
• 01 night accommodation at Marriott Glasgow 4* or Similar in Glasgow
• PCR Test at Outbound Journey & Local Arrival Destination (if applicable)
• Travelling from UAE to Switzerland, COVID-19 regulations lifted on 1 May 2022.
• Travelling from France to UAE, COVID-19 regulations lifted on 9 November 2022.
• Any damages caused to the hotel rooms / Coach during your stay, shall be payable by the passengers.

London, Scotland & Ireland - Christmas Day

London, scotland & ireland - eid, london, scotland & ireland - weekend day, explore more tour packages from dubai, london, scotland & ireland.

Search according to season...

London, Scotland & Ireland - Cherry Blossom Special

You will receive an email containing a link allowing you to reset your password to a new preferred one.

United Kingdom (UK) Tour Packages

Packages available from

AED 990 - AED 3,190/Person

United Kingdom (UK) Tour Packages From Dubai

History and modernity have always been the best combination and if this combination is found at any destination, then don’t miss the chance to get there. Yes, The Travel Makers has also such a destination i.e. United Kingdom (UK). UK destination with a combination of history & modernity and can be shown with the ancient monuments and modern cities with new-designed architectural towers. It doesn’t matter whether you visit Hanover streets, Edinburgh Castle, or any vibrant city like England, Scotland, etc. in the UK… each one will mesmerize your heart and provide the chance to spend the best holiday here. To start your beautiful trip, contact The Travel Makers for United Kingdom Tour packages and explore the amazing blend of this destination. Our UK tour packages from Dubai have all you need to make your trip affordable as well as worthwhile. Get ready to begin by calling +971-4256-2434 and begin your amazing trip with the best travel agency in Dubai.

If you are living outside Delhi, The Travel Makers also have UK tour packages from UAE having flights from different parts of UAE like Abu Dhabi, Sharjah, Ras Al Khaimah, Ajman, Fujairah, and Umm Al Quwain. Get in touch with the Travel Makers and don’t miss the chance to have your customized UK tour package.

United Kingdom Tour Packages from Dubai

Best time to visit the united kingdom (uk).

Is the UK calling you…. but don’t know when to visit?

Before heading to the UK, it is important to research what is the best time to visit. But the UK is an exception…. Your best time to travel to the UK totally depends on your choice. The United Kingdom is full of different experiences in different seasons. You can also say that it is an all-year-round destination. The summers may be warm and the winters may be full of snow. To deal with these choose the ideal time of spring and autumn seasons that fall between March to June and September to November. In these periods, you may find beautiful spring flowers, and changing color of leaves.

How to reach the United Kingdom?

UK top cities like London, Edinburgh, Bath, Cambridge, etc. can be reached by flight. Flights are the most comfortable way to travel and they also play a major role when we need to cover a long distance of 4843 km. Several direct and layover flights by airlines like Emirates, Royal Brunei Airlines, Qantas Airlines, Iberia Airlines, British Airways, etc. cover the distance from UAE to the UK within 10-14 hours. You may find the flights prices high so it is suggested to book in advance. Contact The Travel Makers for last-minute tickets and get affordable rates for your venture.

UK Visa from UAE

As per the new guidelines, from 22 February 2024, UAE citizens can explore the UK without having any tourist visa for up to a period of 6 months. To get an enjoyable vacation, the UAE citizen must apply for electronic authorization. Citizens can apply online and there is no need for documentation. For more details, don’t forget to get in touch with The Travel Makers.

Best places to visit in the UK

The vibrant cities, museums, and historical places are the major attractions in the UK and each has its own uniqueness. Let us check for these places to visit in the UK with the Travel Makers.

There is no doubt that it is a major and must-visit city in the UK with lots of beautiful architecture, vibrant places, and culture. Its modern spirit attracts lots of visitors every year. Some top places to visit in London are Westminster Abbey, Buckingham Palace, London Eye, etc. which are perfect to make the UK a dream-come-true destination.

2) Edinburgh

This city in Scotland is another gem in the UK with lots of extinct volcanoes and rocky crags, and so much more that add more to its beauty. This magical city was once an inspiration for Harry Potter and its Old Town has rich history. You can discover lots of museums, exhibitions, art galleries, and other top attractions in this area.

This is another jewel in Scotland that is also no less from top places to visit and things to do. This city is undoubtedly capable of making you say “Wow” with Glasgow Necropolis, Pollok Country Park, Kelvingrove Art Gallery, and Museum, People’s Palace and so much more.

4) Tower of London

The London City and the Tower of London must not be missed from your UK tour packages. The Tower was once considered a prison from the 11th century to the 12th century but now it is home to the British Crown Jewels. The tower is also popular as the most haunted place in England and so many horror stories have been inspired like the tales of Anne Boleyn, Henry VI, Lady Jane Grey, and many more.

5) The Stonehenge

Any history lover must read about The Stonehenge. It is an excellent prehistoric monument which is all over the world. It is believed that this historic place was made in 3100 B.C.E. and is also on the list of UNESCO World Heritage Sites.

Things to do in the United Kingdom

Just visiting is not enough in the UK. To make your trip memorable, consider these things to do in the UK. These things are:

1) Visit Central London

Any list of exploring just “The London” is incomplete. Start from The Tower of London to Covent Garden and get the true magic of London attractions. There are other historical places and sites like Oxford Street and the Shard are enough to make your trip worthwhile.

2) Walk around the Cotswolds

It is sure that you don’t want to miss capturing the photos of rolling hills and British villages. Choose the Cotswolds in the southern part of England which is one the prettiest regions in the UK. You can easily spend a few days exploring Medieval market regions, beautiful gardens, and historical country houses.

3) Explore Lake District

It is one of the most popular regions in the UK for outdoor adventures. It is in the north part of England which is full of natural wonders like Scafell Pike, and other 16 lakes. This place organizes more than 500 events every year including music festivals and guided tours.

4) Explore Oxford and Cambridge

If you are in London, you can’t miss these popular universities. These universities have former alumni like Charles Darwin and Oscar Wide. Visitors also embrace its Medieval architecture and also walk through the canals in Cambridge. Oxford has also the second largest library in the UK i.e. Bodleian Library.

5) Visit Medieval Forts and Castles

As in the UK, Ireland has lots of grand houses and ancient castles providing truly magical histories. You can head to Kilkenny which is a 12th-century fortress and take you back to the time of Norman Conquest.

To get rich from the United Kingdom, call +971-4256-2434 and start your trip with the best assistance of Travel Makers and their United Kingdom Tour Packages from Dubai

It Costs AED 0 to get a quote.

Best Of Great Britain

• Explore the UK's famous The Great Britain with the Best of Great Britain package and explore the best attractions on the island.

Amazing United Kingdom Scotland & Ireland Combo Tour

• Explore the two famous places Scotland and Ireland with Amazing United Kingdom Scotland and Ireland Combo Tour package within 9 days and 8 nights.

Classic United Kingdom Tour Package

• Explore the UK with Classic United Kingdom Tour Package by The Travel Makers and visit the best of UK in 6 days and 5 nights.

Relaxed Bali for Couples

Accommodation

Sightseeing

More Holiday Destination Packages

Honeymoon packages.

Why Book With us ?

Popular Countries!

Se il vous plaît corriger les erreurs ci-dessous.

Get in touch with us

PCM Travel Agency 1801 The Burjuman Business Tower, 18th Floor, Al Mankhool, Dubai - UAE

[email protected]

• Terms & Conditions
• Privacy Policy
• Cookies Policy

24/7 support:

020 3657 9675

"We accept payments online using Visa and MasterCard credit/debit card in AED".

Copyright © 2024 TheTravelMakers.ae . All Rights Reserved.

• Contact Old
• Travel Insurance

London-UK Tour Packages

Are you planning a trip to the UK from Dubai? Our All-inclusive London-UK Tour Packages from Dubai is the best and cheapest way to explore London-UK Tour Packages from Dubai with your loved ones. Our London-Scotland special vacation package includes return air tickets, hotel accommodation, transfers, tours, etc. Go Kite is the trusted tour operator for London Tour Packages from UAE for your loved ones.

London is your place if you are looking for art or architecture, food or football. London is one of the most popular and oldest cities in the world with its 2,000-year history. Scotland is all about diversity, rolling countryside, stunning cities, icy mountain ranges, lovely villages combine to provide an excellent London Tour package

If you have been searching for the best London-Scotland trip Package this holiday season, your search ends here. You have the choice of booking land packages alone or packages with flights. We will assist you in planning a perfect trip to the UK with your preferred tours, activities, hotels, and more. Contact us today and plan the perfect vacation in London UK.

London Tour Package Cost from Dubai

AED 4,950.00 Per Person on Double/Triple sharing basis

AED 6499.00 Per Person on Single sharing basis

AED 4590.00 Per Child with Bed

AED 3990.00 Per Child

Trip Itinerary

Day 01: wecome- arrive london.

Arrive London meet & greet by representative get transfer to Hotel- Check in- Do you want to make the most of your time in London! Our tours will take you explore the city- the day is free at Leisure – Overnight at London

DAY 02: WELCOME - LONDON- FULL DAY TOUR

Breakfast at Hotel Start off the day with a visit to St Paul’s Cathedral where you enter as their doors open. Explore the masterpiece designed by Wren in 1673 with a professional guide. You can take your time to listen to the 1695 organ that Mendelssohn once played and visit the tombs of Nelson and Wellington. Have your camera at the ready for a photo opportunity outside the famous Westminster Abbey.

Depending on availability, after visiting the impressive Cathedral, you can watch the world famous Changing of the Guard ceremony; a spectacular military march from the soldiers dressed in fabulous tunics and busbies at the official Royal residence of Her Majesty the Queen, Buckingham Palace.

Enjoy some free time to yourselves, where you can take the chance to dine in one of London´s many fantastic restaurants. If you are unsure where to go, your guide will be more than happy to recommend some great places to eat!

After lunch you will pass by London´s most famous landmarks before arriving at the imposing Tower of London. Built in 1066 by William the conqueror, your guide will lead you into this infamous tower of imprisonment and torture regaling you with its gory history. You will have plenty of time to wander the beautiful grounds, view the Crown Jewels and the tour the White Tower.

Finally, take to the water on a cruise of the River Thames. Admire the excellent views of St Paul’s Cathedral, Shakespeare’s Globe, Tower Bridge, the Shard and the Houses of Parliament to name but a few whilst being entertained by your tour guide.

You will have the choice to finish your tour after the cruise, or carry on to visit Harrods, a fantastic shopping centre, and certainly one not to be missed!

DAY 03: STONEHENGE DIRECT AFTERNOON TOUR WITH OPTIONAL FISH & CHIPS LUNCH

Breakfast at Hotel- Unlock the mysteries of Stonehenge, which has puzzled visitors for 5,000 years. Almost 80 monoliths, some even weighing up to 40 tons, have withstood the test of time. How did they get there? What was its purpose? Was it used as a cemetery? Was it an astronomical clock? Learn more about this ancient monument, let your imagination run wild and let yourself be captivated by its silent mystery.

Marvel at this remarkable and mysterious feat of ancient engineering and design with the help of an audio guide. In addition, you can access the exhibitions at the new visitor centre. At Stonehenge, there are many more questions than answers, which explains why this thought-provoking excursion is still one of the most popular in Britain. Do you dare to unleash the Indiana Jones inside you and solve the eternal mystery of Stonehenge? Overnight at Hotel in

DAY 04: LONDON TO EDINBURG

Breakfast at hotel check out and proceed to Edinburg by Flix Bus- On arrove check in to hotel rest of the day is free at leisure

DAY 05: Loch Ness, Glen Coe and the Highlands - Monsters, Mountains and Massacres

Venture through misted glens and the shadows of imposing mountains to experience the magic of the Scottish Highlands on this packed day excursion from historic Edinburgh. Discover stories of mythical monsters, ancient kings and dramatic betrayal against a backdrop of some of the world’s most stunning landscapes.

Travel north from Edinburgh, crossing the arching Forth Road Bridge towards the craggy Perthshire Mountains. Through the rolling grey Monadhliath Mountains, head into Monarch of the Glen country, as famous for its wild stags and warm welcome as it is for its warming Scots whisky. Your first destination is legendary Loch Ness, home of the Loch Ness monster. Some say Nessie is a surviving dinosaur, while others put her appearance down to hoaxes or wishful thinking. Nonetheless, as Loch Ness is one of the deepest lakes in the United Kingdom at 227 metres, there’s plenty of space for a cryptic cryptoid to hide out. Grab your binoculars to scan the lake for anything suspicious, or join one of the groups heading out aboard the Royal Scot for a one-hour monster-spotting cruise.

Heading south, you’ll travel beneath the shadow of mighty Ben Nevis, Britain’s highest mountain. Afternoon refreshment is taken at the entrance to Glencoe, scene of the notorious massacre of the MacDonald clan in 1692, when their guests, the Campbell-led government troops, murdered their hosts in their beds. Finally the tour makes its way towards Stirling, the backdrop for the wars of independence the erstwhile capital of Scotland. You’ll arrive back in Edinburgh in time for your evening haggis.

DAY 06: EDINBURG- GLASGOW

Breakfast at Hotel check out and proceed to Glasgow – on arrive check in to hotel- Over night at Hotel.

DAY 07: OBAN, GLENCOE AND WEST HIGHLAND CASTLES

Breakfast at Hotel-Leaving Glasgow our Oban tour will head west, crossing the Firth of Clyde, where we pass Dumbarton’s famous and imposing rock fortress with its equally impressive castle. We then reach Inveraray, a quaint town built in the mid-18th century on the shores of Loch Fyne. Here we can choose to visit Inveraray Castle* the historic home of the Duke of Argyll, chief of the Clan Campbell, nestled in large beautiful gardens overlooking Loch Fyne. Alternatively, explore the town’s white-washed Georgian houses, wide streets and breathtaking views across the loch.

The Oban tour will then climb further north into the Highlands through stunning scenery, and a route marked by several dramatic castles and beautiful lochs. We then pass Kilchurn Castle, one of Scotland’s most photographed castles, nestled on the banks of Loch Awe and beautifully framed by mountains.

Next we make a stop for lunch in the picturesque harbour town of Oban, ‘Gateway to the Isles’, with free time to explore its horseshoe bay and see McCaig’s Folly, an iconic 19th century tower reminiscent of the Colosseum in Rome. After free time exploring, we travel onwards past the 15th century Castle Stalker, which is set on a small island on Loch Laich, before reaching Glencoe, one of Scotland’s most haunting glens and site of the 1692 massacre of the MacDonald clan.

Our return journey takes us over the dramatic landscape of Rannoch Moor and the Black Mount before we make our final stop at the pretty conservation village of Luss on the ‘Bonnie, Bonnie Banks’ of Loch Lomond. Here we can walk along the shore or admire the village before returning to Glasgow where your Oban tour will end. Overnight at Hotel

DAY 08: DEPARTURE

Breakfast at Hotel check out and fly back home after memorable Trip

• Return Air Tickets
• 20 Kg baggage
• Accommodation
• 3N Stay at Hotel Ibis London Wembley Hotel or similar
• Bed & Breakfast
• 2N Stay at Hotel Edinburg or similar
• 2N Stay at Hotel Glasgow or similar
• London Full Day Tour
• Stonehenge Direct Afternoon Tour with Optional Fish & Chips Lunch
• Loch Ness, Glen Coe and the Highlands – Monsters, Mountains and Massacres
• Oban,Glencoe and West Highland Castles
• Professional English Speaking Guide for tours
• Tours on SIC basis
• London-Edinburg- Glasgow by Luxury Coach
• Train station- Hotel transfers
• Personal Expenses
• Any tours or activities not part of the package
• Any Meals or drinks not part of the package
• Early Check in- Late Check out

Terms & Conditions

• Rates are subject to
• Above is just a quote, no booking made
• Peak season surcharges may apply on some
• Itinerary is subject to change / swap without any prior notice
• There will not be any refund for any unutilised service or sightseeing
• In case of unavailability in mentioned hotels, alternate accommodation will be arranged in a similar category
• Any meals and services unless mentioned in the itinerary are not included
• You are fully responsible for verifying and obtaining the documents required for your trip and visa
• Check In to the hotel is always 1400/1500 hours & Check Out is always 1100/ 1200 Early Check in and late checkout is subject to availability unless & otherwise specified in the inclusion column
• City Tax Be Paid directly at the Hotel
• Tours are based on tour Departure Points

01 March 2022 to 30 April 2023

Advanced Confirmation

Want to speak to a travel expert?

Let our team of experts help you pick the best option for you!

You are using an outdated browser. Please upgrade your browser to improve your experience.

We use cookies to improve your website experience and provide more personalized services to you, both on this website and through other media. By continuing to use this website, you agree to our use of cookies as explained in our Cookie Policy . Please read our Cookie Policy for more information on how we use cookies and how you can disable them.

New User? Register

• Manage bookings
• Cancellation
• On Behalf Booking

We're unable to sign you in because the password entered incorrect.

Your request for OTP will be sent to registered email id and mobile number, if not registered please do the same.

You exceed the OTP limit. Please try again after some time

Don't have an account?

• Contains between 8-12 alphanumeric characters.
• Can add special character but not mandatory(Only !, @, #,$,%,^,&,* to be used).
• Does not contain White spaces

I would like to be kept informed of special Promotions and offers. I hereby accept the Privacy Policy and authorize Thomascook to contact me.

Already have an account?

• Your existing Google or Facebook Id will be a Thomascook ID
• No need to remember different Ids & Passwords
• One Click login

Fill in the email Address that you used to register or book with Thomascook.

We will reset and send your new password.

Please enter the valid email address

Thomascook Staff / Preferred Agents / corporate's, please enter your Login-id only. E.g. Tcil_aalok / Jaft_prakash / Rc_mumbai

Your request for new password has been accepted.

The new password would be emailed to the registered email address, if not registered please do the same

The page you searched is temporarily unavailable

Kindly use the links below..

• international tour packages
• united kingdom tour packages

Oops! We could not find any result for the given search.

Sorry, the fields marked in red need your attention, please fix them to continue.

United Kingdom Tour Packages

Holiday tour packages (trending).

International Tour Packages

India & Around Tour Packages

I accept Privacy Policy and I authorise Thomas Cook Group Companies to contact me.

International Tour Packages (Trending Destinations)

Europe Tour Packages

Stroll through the beaches and explore the wild in the cultural island with your better half. Maldives is an all-in-one experience.

USA Tour Packages

Visit USA - the third largest continent in the world. Packed to the brim with personality, charm, diversity and great natural beauty.

Australia Tour Packages

A trip to Australia is a must if you crave for a blend of adventure, scuba diving, colorful mountains, rich wild life and much more.

New Zealand Tour Packages

Unending vistas of breath-taking landscapes await you at New Zealand – Fall in love with huge mountains, clear waters, adventure, wildlife & more.

Asia Tour Packages

The land of hidden gems, unexplored grasslands, temple towns, bustling streets and golden beaches; this is Asia for you.

Mauritius Tour Packages

They say that Mauritius was fashioned out of the handbook of the Gods. For the most part, it’s true.

Singapore Tour Packages

Bling and sparkles everywhere with tall buildings, scrumptious food, and lightning speed transport - Singapore deserves a spot on your ultimate holiday bucket list.

India Tour Packages & Around

Andaman Tour Packages

The Andamans - A wonderland of teal and turquoise. Where the seafood is more flavourful, and the fruits are juicier.

Kerala Tour Packages

Welcome to God's own country. Kerala is where tranquil backwaters, manicured tea estates, enchanting forests, beguiling mountains await you.

Himachal Tour Packages

The land of Gods awaits your visit. Choose to relax & enjoy its stunning beauty with the love of your life or wish to heed your spiritual call & discover yourself.

Rajasthan Tour Packages

Rajasthan synonym Royal, Regal, Revered. A magical universe of colour coded kingdoms. A place where little red turbans and green saris dance to classical music.

Kashmir Tour Packages

Experience Heaven on Earth. Beautiful verdant mountains and valleys, religious shrines, temples, wildlife, art and culture, festivals and much more.

Sri Lanka Tour Packages

A teardrop, found sliding along the Indian Ocean, is the magical land of Sri Lanka. It's is a magical, beautiful and diverse nation.

Bhutan Tour Packages

Bhutan is a jumble of impressions. A melange of sight, sound and taste. And its a one of a kind place where happiness is measured.

An extraordinary island nation that comprises of England, Scotland, Wales and Northern Ireland, The United Kingdom is indeed home to some of the worlds most prized possessions – The Beatles, U2, Harry Potter, Fish and Chips, whiskey, bagpipes and the list goes on… In terms of natural beauty, history, culture, art, cuisine, commerce, sports and recreation, this sovereign country has earned a gold star! From electrifying cities to magical countrysides, there’s no shortage of picture-perfect vacation backdrops. Which is why we’d recommend one of Thomas Cook’s UK tour packages for your next trip abroad!

Most Popular UK Tour Packages

Thomas Cook’s international UK packages have been carefully crafted, with the utmost care and competence, to ensure that customers have the most memorable trip. As always, the aim is to create affordable and accessible holidays. Individuals may select from 24 packages, that range from 6 nights and 7 days to 21 nights and 22 days. With thrilling itineraries, 3-4-star hotels with daily breakfasts and hot water facilities as well as transportation vehicles, individuals will have access to all the comforts and conveniences they desire.

Depending upon the UK tour selected, travellers will have the opportunity and privilege of touring some of the most charming, quaint, historic and cultural destinations in the world. From London’s prevailing crowns to Edinburgh’s mediaeval castles, Manchester’s bold sporting culture and Glasgow’s thriving theatre scene, there’s a myriad of things to see and experience. What’s more, you’ll get to explore the ancient glamour of Carlisle, Durham and Inverness too! These are not your average UK holiday packages because they also include trips to other parts of the diverse European continent, including Paris, Brussels, Rhineland, Bellinzona, Cologne, Eindhoven, Vevey, Bordeaux, San Sebastian, Barcelona, Rome, Florence, Venice, Lucerne, Durham, Turnhout and Frankfurt. 

So, are you ready to marvel at the museums and palaces, salivate at the steaks and pies, groove to the Irish folk music and sing to the classics? Yes, your UK trip will be filled with all the good things in life – food, music, people, sceneries… All you have to do is select from one of our UK holidays and you can be on your way to the land of the Royals! We’ve put together a list of the top 10 places to visit in the UK for an exceptional time!

Refine Search:

Must Include Places

Departure City

Price Per Person

Approx price per person

Month of Travel

Package Type

• ( 1 ? 'N':'N' --> ) →
• Optional Flights

Sightseeing

Tour manager, 0 --> rs. 0 --> rs. 0 --> rs. rs. 0) --> % off.

Starting price per adult

Final EMI value will be displayed post the total package cost is calculated

Above points are approximate & calculated for Silver tier members, actual points will be credited basis your membership, after your travel is completed.

• Silver Member - 1%*Total value ( Net )
• Gold Member - 1.5%*Total value ( Net )

For more information, click here

Round trip Flights included

  flight optional.

• 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' --> 1 night

All about United Kingdom

United Kingdom Tourism

Places To Visit in United Kingdom

Best Time to Visit United Kingdom

How To Reach United Kingdom

United Kingdom Photos and Videos

United Kingdom Visa

United Kingdom Packages

Famous places to visit in united kingdom.

Tower of London

Westminster

Buckingham Palace

Trafalgar Square

Natural History Museum

Madam Tussauds

Kew Gardens

St Pauls Cathedral

Trending India Destinations

Trending international destinations.

America Tour Packages

Thailand Tour Packages

Dubai Tour Packages

Malaysia Tour Packages

Maldives Tour Packages

Nepal Tour Packages

United Kingdom Flights

Unitede kingdom packages from city.

United Kingdom Tour Packages From Mumbai

United Kingdom Tour Packages From Chennai

United Kingdom Tour Packages From Bangalore

United Kingdom Tour Packages From Delhi

United Kingdom Tour Packages From Kolkata

United Kingdom Tour Packages From Ahmadabad

United Kingdom Tour Packages From Hyderabad

United Kingdom Tour Packages From Cochin

Click on destination labels to get refined search.

• 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' -->

Get the Best Holiday Planned by Experts!

Enter your contact details and we will plan the best holiday suiting all your requirements.

I hereby accept the Privacy Policy and I authorise Thomas Cook Group Companies to contact me.

Maximum Limit Exceeded!

You can select max 3 packages to compare

I want to holiday in

Tell us what you need? & Let your Holiday expert design package for you.

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• Festive Offers
• Holidays 2024

Dubai Holiday Offers

• Last Minute Escapes
• Atlantis The Palm Offers
• Ras Al Khaimah Holidays

Middle East

• Ras Al Khaimah

Indian Ocean

• All-inclusive Holidays
• Beach Holidays
• Business Class Holidays
• Family Holidays
• Luxury Holidays
• Winter Sun Holidays
• London Heathrow
• London Gatwick
• London Stansted
• Additional Services
• In-Resort Service
• Opening Hours
• Pay My Balance
• 020 8972 8951
• Flight + Hotel

Search Holidays

• Manage My Booking
• London - All Airports
• London Gatwick (LGW)
• London Heathrow (LHR)
• London Stansted (STN)
• Birmingham (BHX)
• Manchester (MAN)
• Newcastle (NCL)
• Glasgow (GLA)
• Edinburgh (EDI)

Dubai is home to a world of wonders for those adventurous to discover it. With something for every kind of traveller, Dubai is perfect for your next holiday. For those looking for a relaxing retreat, you will find some of the world’s best resorts, whether on the iconic Palm Jumeirah , bustling Downtown Dubai , the world-famous Jumeirah Beach or enjoying cafe culture along The Walk . Thrill-seekers will be in their element, with a plethora of high-octane theme parks and water parks, such as Dubai Parks and Resorts, Aquaventure Waterpark, IMG Worlds of Adventure, Wild Wadi Waterpark and so much more. It doesn’t stop there though; you could be racing down the slopes of Ski Dubai , reaching the dizzying heights of the world’s tallest building at the Burj Khalifa or soaring high above Dubai on a Seawings Seaplane Tour . Experience this and so much more on your next getaway. Find out more about a tantalising holiday in Dubai here .

Beyond that, Dubai is also home to the world’s largest shopping mall, The Dubai Mall , with more than 1,000 designer stores and boutiques where you’re guaranteed to find presents for all the family (or yourself). Aside from the largest mall in the world, Dubai also has a variety of bustling, traditional souks and shopping centres to cater for everyone’s shopping needs.

View our Dubai holiday offers below and book today to enjoy guaranteed savings, low deposits from £100, complimentary meal and room upgrades and many more extras to make your next Dubai holiday truly special. Book online or call us for more information on 020 8972 8951 .

• Three complimentary sessions at Atlantis Explorers Club and The Zone

Atlantis, The Palm, Dubai

• 5 nights from £2,049pp
• Ocean Room Queen
• Travel on selected dates from 24 to 30 October 2024
• Return Emirates flights from London Gatwick
• Price based on 2 adults and 2 children

Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.

• Kids Eat and Stay Free

The Ritz-Carlton Dubai

• 5 nights from £1,629pp
• Half Board Dine Around
• Deluxe Room
• Return Emirates flights from London Heathrow

• Unlimited access to Wild Wadi Waterpark

Jumeirah Beach Hotel, Dubai

• 5 nights from £1,929pp
• Deluxe Room Ocean with Balcony
• Return Emirates flights from Manchester

• Complimentary Half Board upgrade

Anantara The Palm Dubai Resort

• 5 nights from £1,195pp
• Deluxe Lagoon View Room
• Travel on selected dates from 01 to 30 October 2024
• Return Emirates flights from Birmingham

• Access to Jungle Bay waterpark

The Westin Dubai Mina Seyahi Beach Resort & Marina

• 5 nights from £1,219pp
• Deluxe Skyline
• Return Emirates flights from Glasgow

• Kids Eat Free

Lapita, Dubai Parks and Resorts, Autograph Collection

• 5 nights from £939pp
• Half Board Plus
• Deluxe Twin Room Resort View with Park access
• Return Emirates flights from Newcastle

Dubai Family Holidays

Luxury Dubai

Desert Escapes

Downtown Dubai

Explore Dubai

All-inclusive Dubai

Dubai Beach Holidays

Dubai City Breaks

Join the emirates holidays community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Holidays?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates
• Enjoy rewards with Emirates Skywards

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

Holidays in Dubai

Search hundreds of travel sites at once for holiday package deals in dubai.

Let KAYAK do the searching

Save on your next holiday

Search and compare hundred of travel sites at once for holiday packages in Dubai

We’re completely free to use - No hidden charges or fees

Filter by free cancellation, free breakfast and more

ATOL Protected: All packages are ATOL protected

Cheap Dubai package deals

Most popular dubai flight and hotel deals, all inclusive holiday packages to dubai, last minute holiday packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a holiday in dubai, tips for finding cheap holiday packages dubai.

• There are loads of types of holidays in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travellers: Top holiday £357; Family holiday £321; Romantic holiday £446; Luxury holiday £416; Budget holiday £252.

Why should you book a holiday package to Dubai?

With a good Dubai holiday package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven

When should you book a holiday package to Dubai?

The winter season in Dubai is the perfect time to take a holiday on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.

Where should you stay in Dubai during your holidays?

For any holiday type in dubai:.

Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.

Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.

For family holidays in Dubai:

The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.

Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.

For romantic holidays in Dubai:

Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.

Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.

For luxury holidays in Dubai:

With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.

The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.

For budget holidays in Dubai:

City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai holiday deals

Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.

Dubai is located in the United Arab Emirates off the coast of the Persian Gulf. Located right on the edge of an ocean, Dubai has a tropical desert climate and one of the world's most successful tourist industries.

Planning a Dubai Holiday

Before deciding to hop on plane to Dubai, it is wise to take note of the climate. Temperatures in Dubai can range anywhere from 14°Celsius to the upper thirties. To avoid the extreme heat of summer, a trip during the milder months of November through April is advisable. The time zone is GMT+4.

Holidays in Dubai: Attractions to visit

Visiting the beaches is a must on Dubai holidays. The Jumeriah Park beach is open until 6pm and the Marina Beach is open after 6pm. While enjoying the warm weather, take the time to experience various outdoor activities such as Mushrif Park - one of the largest and most popular public parks in the city - desert safaris, hot air balloon rides, the Dubai Aquarium and Underwater Zoo and even unusual attractions like the indoor snow skiing centre in the Mall of the Emirates. Aside from indoor skiing, the Mall of the Emirates is also one of the most popular shopping attractions. Another must see in Dubai is the architecture. For a city in the middle of a desert, it is one of the most beautiful, contemporary, and futuristic cities in the world. Take the time to see the Burj Khalifa, the world’s tallest building and take a few pictures of the famous Burj al-Arab, the picturesque hotel built to resemble the sail of a ship. The excitement of this modern city offers a wide range of attractions to the vistor, making Dubai holidays an ideal choice.

Where to stay in Dubai

Dubai holiday information, other popular package holiday destinations.

• Paphos package holidays
• Vancouver package holidays
• Dublin package holidays
• Montego Bay package holidays
• Copenhagen package holidays
• Venice package holidays
• Berlin package holidays
• Abu Dhabi package holidays
• Myrtle Beach package holidays
• Key West package holidays
• Orlando package holidays
• Sharjah package holidays
• Ajman package holidays

• Special Offer

• Call Our Experts On: +44 791 560 8252
• [email protected]

Tour Packages

All packages.

Dubai With Aravi Hotel 4 Nights 5 Days Christmas Holiday Package

5 days | 4 nights, starting from: £400.00 £240, trip includes:.

• Transportation
• Entrance Tickets For The Mentioned Attraction
• Air Conditioned Vehicles
• Sightseeing

Citymax Hotel Bur Dubai & Aloft Abu Dhabi 4 Days Dubai New Year Package

4 days | 3 nights, starting from: £300.00 £180.

Dubai With Citymax Hotel Bur Dubai 3 Nights 4 Days New Year Package

Starting from: £490.00 £294.

Dubai With Wyndham Dubai Deira 2 Nights 3 Days Christmas Package

3 days | 2 nights, starting from: £175.00 £105.

Dubai With Atlantis The Palm & Lavender 3 Nights 4 Days Summer Holiday Package

Starting from: £590.00 £354.

Best of Abu Dhabi New Year Holiday Package Tour

Starting from: £108.00 £65.

UAE Long Holiday Best Package Tour

12 days | 11 nights, starting from: £855.00 £513.

Valentines Long Celebration in UAE Package Tour

8 days | 7 nights, starting from: £449.00 £270.

A week of Luxury Valentines Celebration in Dubai Tour Packages

7 days | 6 nights, starting from: £374.00 £225.

• Hi, My Account Subscriptions --> My KT Trading Contact Us Privacy Notice Sign Out

Tue, May 14, 2024 | Dhu al-Qadah 7, 1445

Dubai 20°C

• Expo City Dubai
• Emergencies
• Ras Al Khaimah
• Umm Al Quwain

Life and Living

• Visa & Immigration in UAE
• Banking in UAE
• Schooling in UAE
• Housing in UAE
• Ramadan 2024
• Saudi Arabia
• Philippines
• Cryptocurrency
• Infrastructure
• Currency Exchange
• Horse Racing
• Local Sports

Entertainment

• Local Events

Dubai World Cup

• Track Notes
• Big Numbers
• Daily Updates
• Arts & Culture
• Mental Health
• Relationships
• Staycations
• UAE Attractions
• Tech Reviews
• Motoring Reviews
• Movie Reviews
• Book reviews
• Restaurant Reviews
• Young Times

Supplements

• Back To School
• Eid-Al-Adha
• It’s Summer Time
• Leading Universities
• Higher Education
• India Real Estate Show
• Future Of Insurance
• KT Desert Drive
• New Age Finance & Accounting Summit
• Digital Health Forum
• Subscriptions
• UAE Holidays
• Year of the 50th
• Latest News
• Prayer Timings
• Cinema Listings
• Inspired Living
• Advertise With Us
• Privacy Notice

KT APPDOWNLOAD

Gcc 'grand tours' visa: for dh4,000, visitors can soon explore multiple gulf countries, the visa will be similar to schengen visa, allowing access to all six gulf countries.

Waheed Abbas

• Follow us on

Embracing the bright side: A guide on how to cultivate optimism

The power of solitude: Why you should go on a solo trip

How to get your kids to read: Essential tips for parents

Published: Mon 13 May 2024, 6:00 AM

Last updated: Mon 13 May 2024, 10:20 PM

Travel agencies in the UAE and abroad are all set to roll out packages for tourists visiting the Gulf region ahead of the launch of the unified GCC tourist visa or GCC 'Grand Tours' visa.

Travel and tourism industry executives said packages, which will include a couple of night stays, travel and sightseeing in three countries in the region, could cost visitors around Dh4,000-Dh5,000 and above.

During a ministerial discussion at the Arabian Travel Market last week, officials said the 'GCC Grand Tours' visa could be in place by the end of this year. The multi-entry visa will be similar to Schengen visa allowing access to all six Gulf countries.

Stay up to date with the latest news. Follow KT on WhatsApp Channels.

Rehan Asad, vice-president for global markets at Expedia, said the unified GCC tourist visa is a positive change for the region.

He said when Europe launched the Schengen visa, it amplified the region’s tourism sector and allowed people seamless access to several countries.

“People from the UAE love to travel to Saudi Arabia and Oman, and vice-versa, hence, this new visa will drive intra-country traffic and boost tourism further.”

The Expedia V-P said they have conducted research to assess people's needs.

"People want convenience during the GCC tour. We found out that children aged 8-14 play a critical role in deciding a family's destination and hotel stay. We have conducted a research among a population of 10 million people and will be rolling out packages based on people's needs. It will be a combined hotels, cars and tour activities package,” he said.

Stating that their "initial focus will be the UAE followed by Saudi Arabia", Asad said the packages will be “dynamic and not pre-bundled” and people will have several options to choose from.

Welcoming the unified GCC tourist visa, Anas Anane, associate executive at Traveazy, said the visa will be a huge advantage for the travel and tourism sector.

“The tour packages will start from Dh1,500 per person for one country, including flights and sightseeing. The cost will also depend on the peak or off-peak tourist season in the GCC countries.”

He said the packages would approximately cost Dh4,000-Dh5,000 for a couple of days' stay each in UAE, Qatar and Saudi Arabia, covering flights, hotels, transfer and excursions in select countries.

Dubai in focus

Mohammed Farooz, executive secretary at Last Minute Tourism, said many companies are already working out tour packages. “We will have a package for Dubai, Oman and Qatar in a couple of months. This will include three nights each in Dubai and Oman; or three nights each in Dubai and Qatar. People who will buy our packages will first land in Dubai and then move on to next destinations in the region,” he said.

Farooz said bundle offers are going to be 25 per cent cheaper than regular packages.

Ross Veitch, chief executive officer and co-founder of Wego, said the unified GCC tourist visa will be a big incentive for inbound tourism and also for residents of the regional countries.

“The unified GCC visa will make the region even more popular, especially among the Chinese inbound visitors, in the same manner we have seen in Europe and Southeast Asia. It is common among Chinese visitors to land in Bangkok, and spend a few days in Thailand, followed by a few days each in Malaysia, Singapore and Indonesia. I think tourists will do the same in this region with the unified tourist visa. They can land in Jeddah, then come to Dubai and Ras Al Khaimah, and then return home,” said Veitch.

He said people are increasingly mixing business and leisure travel in the post-Covid period and that the trend will gain momentum once the unified GCC tourist visa is in place.

• 1 visa, 6 countries: Unified GCC entry permit to boost business-leisure travel
• Unified GCC tourist visa: System will be in place by end of 2024, UAE official says
• UAE tourism sector set to boost GDP share to Dh236b in 2024
• Newsletters
• [email protected]

More news from Business

The role of tax treaties in transforming corporate tax landscape in uae.

By utilising beneficial provisions, companies can gain a competitive edge

business 1 day ago -->

Mubadala Capital to invest $13.5b in Brazil’s biofuel sector

The move is part of a broader investment plan, including the creation of a new stock exchange

Demand surge, weak dollar seen to bolster gold prices

The precious metal has climbed approximately 12% this year

IIHL targets $50b valuation through acquisitions

IIHL’s current BFSI business includes IndusInd Bank and Invesco

UAE firm to perform live telerobotic surgery trial at Abu Dhabi Global Healthcare Week

Live showcase of remote robotic surgery for emergency procedures

Nongshim expands community engagement at the Dubai Esports and Games Festival

Korean food brand recently forayed into halal sector

Wall St Week Ahead: Earnings bolster US stocks but crucial inflation report looms

The benchmark S&P 500 index is up over 9% for the year

UAE-India Cepa Council inks pact with Indian business body

The MoU establishes a broad-based partnership between the participants

business 2 days ago -->

Type your keywords

Deals of the Week   All of Europe's finest   Up to 50% OFF

UAE Tours & Trips 2024/2025

The glittering cities of Dubai and Abu Dhabi will give the traveller a glimpse into the wealth of the oil-rich United Arab Emirates. Embark on a UAE adventure by 4WD on a desert safari and surf the sand, or ride high on the back of a camel. Taste delicious Arabic cuisine as you watch an Arabian sunset from a cool oasis.

132 United Arab Emirates tour packages with 181 reviews

Magical Dubai

Great experience in Dubai

The UAE Complete - Escorted Tour in 4* Hotels – Full Board Plan

This was an excellent tour for an introduction to the UAE. Our guide was very knowledgeable and always ready and available to help. I'm really happy to recommend this tour to everyone and Anish Eltho, from customer support was an awesome guy and was really helpful.

• Christmas & New Year

Dubai Escape

It was a great experience. Everything was organized nicely.

The UAE Essentials - Escorted Tour in 4 Stars Hotels – Full Board Plan

My UAE trip with Grayline UAE was simply amazing. Great tour! The tour guide of Grayline was very knowledgeable and amusing! Driver was equally nice. The visit to the Sheik Zayed mosque, palaces, art gallery and date market were great! The buffet meal provided during the tour was reasonably priced and tasty. I would definitely go on this tour again. Take cash and stick to a budget if you plan to buy anything at the art galleries - they are very persuasive and would make you buy all the stuff in them! And you'll end up buying more than you intend! Great experience! Awesome time spent with Dubai Private Tour!

Best of Dubai Tour - 7 Days Luxury Tour

great experience I Had

• In-depth Cultural
• Sightseeing

Explore Dubai & Abu Dhabi 4 Nights 5 Days

They were very prompt or contacted us to let us know if they were running late. The transfer from the airport was good. They allowed us to choose from several great hotels. The activities were the highlights of any tour to Dubai. I would definitely recommend this package to my friends and family if they are coming to Dubai.

Dubai Luxury Holidays Package 6 Night 7 Days

It was good tour. Thanks to all the team.

Looking for tours beyond just United Arab Emirates?

Explore tours with itineraries going through multiple countries, including United Arab Emirates.

Best of Dubai Tour- 6 Nights and 7 days (4 star Luxury Apartment Hotel)

My Dubai tour was an absolute delight. The city's stunning skyline, rich culture, and luxurious attractions surpassed all my expectations. From traditional souks to futuristic skyscrapers, Dubai offers a unique blend of old and new. Thanks to Relax Gateways and their meticulous planning, every moment was smooth and enjoyable. If you're looking for a destination that offers a perfect mix of modernity and tradition, Dubai is the place to be. Dubai offers you a lot of activities to do. Go for it.

• Book With Flexibility This operator allows you to rebook your dates or tours with them for free, waiving change fees.

Dazzling Dubai

I did the Dubai/Abu Dhabi trip in October 2018. I was shocked that all was seamless. The choice of hotels were top notch. Our travel rep in Dubai/Abu Dhabi was so knowledgeable and helfpul. Really, nothing negative to say. Only comment but this is more of a personal preference, I would have rathered spent the entire time in Dubai with a 1 day excursion to Abu Dhabe as opposed to splitting it up as there is more to do in Dubai. I was impressed as were my travel buddies.

Amazing Abu Dhabi and Dubai

We got more than we expected great value for money.will travel with Indus again

09-Day Dubai Family Explorer tour

Stars of Dubai - 6 days

All of the tour guides were excellent and very knowledgeable. My only issues were that we paid for a 5 star hotel and we got a 4 star hotel. I let a representative know about this hotel discrepancy and nothing was done or corrected. It was never addressed. Also, we were not informed that we would not be seeing certain listed sites until I asked why we didn't see them. I was then told they were closed due to Covid. Those sites are still listed in the online brochure and thus included in the price.

Dubai & Emirates - 8 days

Very well arranged tour with constant communication. The package included everything I wanted to see. We had the perfect amount of group time and independent time. I really liked having a different group of people each day. I will definitely be booking another trip with this company Thank you to all who made this possible.

Customized Private Dubai & Abu Dhabi Vacation with Daily Departure

Best Dubai tour with 4 star luxury Hotel Accommodation

What people love about united arab emirates tours.

Sehr viel gesehen, sehr gute Organisation, gutes Essen, ausgezeichneter Reiseleiter, insgesamt sehr zufriedenstellend. Allerdings: Beworben wurde die Reise mit einer maximalen Gruppengröße von 20 (!), was ein wesentliches Motiv für die Buchung war. Tatsächlich war die Gruppengröße 39 - 41, also doppelt so groß!!!! Wie vertrauenswürdig sind eigentlich die Angaben zur Reise? Wäre die Gruppengröße mit max 40 Personen angegeben gewesen hätten wir diese Reise NICHT GEBUCHT!

Tour bus audio system wasn't working properly so couldn't hear what tour guide was talking about.

Travel Styles

• Small Group (15)
• Budget (17)
• Luxury (14)
• Singles and Solo (88)
• For Couples (8)
• Seniors (32)
• Family (105)
• Explorer (79)
• Partially Guided (62)
• In-depth Cultural (41)
• Personalized (39)
• Fully Guided (35)
• Custom (21)
• Private (18)
• Active (16)
• Jeep & 4WD (6)
• 3 Day Tours (6)
• 7 Day Tours (68)
• 10 Day Tours (20)
• 2 Week Tours (5)
• Spring 2024 (91)
• Summer 2024 (96)
• Fall / Autumn 2024 (96)
• Winter 2024 / 2025 (92)
• Spring 2025 (58)
• Summer 2025 (42)
• Fall / Autumn 2025 (40)
• Winter 2025 / 2026 (23)
• May 2024 (92)
• June 2024 (92)
• July 2024 (96)
• August 2024 (96)
• September 2024 (96)
• October 2024 (92)
• November 2024 (92)
• December 2024 (87)
• January 2025 (68)
• February 2025 (59)
• March 2025 (58)
• April 2025 (52)
• May 2025 (46)
• June 2025 (42)
• July 2025 (42)
• August 2025 (40)
• September 2025 (40)
• October 2025 (28)
• November 2025 (28)
• December 2025 (23)

United Arab Emirates Tours starting in

• Starting in Dubai (90)
• Starting in Abu Dhabi (5)

Discover TourRadar

• See All Tour Operators in Asia
• See All Tour Operators in United Arab Emirates
• Serengeti Safari
• Sailing in Turkey
• India Varanasi tours
• Deals of the Week
• 10 Best Nepal Trekking Companies & Tour Operators (with 31,613 Reviews)
• Permits for Mont Blanc : How to Get them
• Serengeti Weather & Climate: All You Need To Know

• WEB STORIES New
• ENTERTAINMENT
• CAREER & CAMPUS
• INFOGRAPHICS
• ISL 2023-24

• Manorama Online
• Manorama News TV
• ManoramaMAX
• Radio Mango
• Subscription

Gulf Grand Tours visa: Travel agencies to launch unique tourist packages

Dubai: Travel agencies in the UAE and other countries are busy preparing special packages ahead of the much-awaited rollout of the ‘Gulf Grand Tours’ visa, which introduces a unified tourist visa system for the GCC (Bahrain, Kuwait, Oman, Qatar, Saudi Arabia, and the United Arab Emirates) countries. The executives in the travel and tourism sector say that the packages aim to attract tourists from all over the globe who wish to visit the Gulf region. These packages would be designed based on the European Schengen visa model.

Travellers will have to spend around 4000 – 5000 dirhams or more, to enjoy leisure trips, including two-night stays at three countries in the region. At a ministerial summit held as part of the Arabian Tarvel Market last week, it was announced that the unified visa system will be in place by the end of this year. The authorities hope that the multi-entry Grand Tours Visa will let tourists travel to the six countries without any hassle. 

First phase focuses on Saudi Arabia Travel agencies say that they have been designing packages after doing proper research to understand the needs and preferences of the travellers. Their study found that children aged between 8 and 14 play pivotal roles in choosing the destination and the family’s stay in hotels. Based on this information, the travel agencies aim to develop unique tour packages to attract more than a million tourists to this region. These packages include hotel accommodation, vehicle rent and entertainment activities for families. In the first phase, such packages would concentrate on trips to Saudi Arabia.

Munnar sees biggest crowd since 2006: How to enjoy the spot avoiding traffic congestion?

Dubai launches air taxi service: Passengers can reach various spots in the city in 10 minutes

The different packages The cost of the packages would depend upon the tourism seasons in the GCC countries. The package for a two-day trip to countries like the UAE, Qatar and Saudi Arabia would cost up to 4000 – 5000 dirhams. Some tour operators are also thinking of packages for a single country for 1,500 dirhams. Interestingly, the packages would cover the expenses for air tickets, hotel accommodation as well as transfers and tours. Meanwhile, the tour packages to Dubai, Oman and Qatar are expected to be ready for launch in two months. This package includes a three-night stay in Dubai and Oman or Dubai and Qatar. The travel agencies believe that the Grand Tours Visa would boost the scope for inbound tourist and domestic travels. After the Covid 19 outbreak, people have been preferring trips that combine leisure with business. The authorities and the travel agencies hope that the Grand Tours Visa may bolster such trends.

An initiative to attract international tourists It was in October last year that the GCC unanimously approved the unified visa system, in the model of the European Schengen visa. In April 2024, UAE’s Minister of Economy Abdullah bin Touq Al Marri announced that the GCC countries would roll out the unified visa system by the end of the year. He added that a unified tourist visa system would surely play a major role in attracting international tourists to the GCC countries. The Gulf Grand Tours Visa would also be beneficial for expatriates, especially Indians, residing in various Gulf countries.

Flights to Kozhikode diverted to Kochi and Kannur airports due to inclement weather

Rains, gusty winds lash parts of Mumbai; Metro, local train services hit

Will the Railways show the green light for a brand new MEMU?

Oman – Abu Dhabi railway: Hafeet rail to boost tourism in the area

Kakkayam eco-tourism centres reopen after 3-months closure

Thiruvananthapuram-Mangaluru Vande Bharat timings revised, will come into effect on May 13: Details

Express. Home of the Daily and Sunday Express.

• Your Account
• Newsletters

Tiny tropical island with year-round sun and direct flights is a package holiday hotspot

A sun-soaked tropical haven is rising in popularity with british airways naming it the "most searched" package holiday destination so far this year..

Package holidays are a fantastic option for Britons who want to pay for everything ahead of their travel and limit the risk of unexpected costs while abroad. According to new data released by British Airways , there is a small Caribbean destination which has been named the "most searched for" package holiday destination for 2024.

St Kitts, with 261 square kilometres of territory, and roughly 50,000 inhabitants, is the smallest sovereign state in the Western Hemisphere.

READ MORE Italy’s most walkable city is one of Europe’s prettiest holiday destinations [INSIGHT]

However, according to data from British Airways' latest Travel Trends Report, it's a thriving package holiday hotspot which has seen a 97 percent increase in package holiday searches this year.

Though smaller than its neighbouring islands of Barbados and Antigua, the island has an excellent offering for tourists, including its toasty year-round temperatures and lots of sunshine.

St Kitts experienced average highs of approximately 28C throughout the year, and though the islands of St Kitts and Nevis have a wet season between July and December, temperatures remain warm.

Though you can take connecting flights from the UK to St Kitts, British Airways flies direct to St. Kitts’ Robert L. Bradshaw International Airport (SKB) twice a week from London's Gatwick Airport .

DON'T MISS Europe’s ‘best budget city break’ where you can enjoy a beer for £3.20 [INSIGHT] The world's 'most stressful tourist trap' has been named [EXPLAINER] 5 of Europe's sunniest destinations in May [DATA]

According to British Airways: "The cheapest month to fly to St. Kitts is generally May or June when you can save on flights and accommodation and still enjoy the balmy tropical weather. Peak high season for tourists is from December to April."

Holidays tend to be more affordable if you travel outside of the peak season, with British Airways noting that many Britons are choosing to travel during the "shoulder seasons" in a bid to save money.

The growth in searches from customers looking to travel in May and June 2024 was double the level for trips in July and August 2024 when compared to the same period in 2023.

We use your sign-up to provide content in ways you've consented to and to improve our understanding of you. This may include adverts from us and 3rd parties based on our understanding. You can unsubscribe at any time. Read our Privacy Policy

On the island's southwestern coast is the capital, Basseterre, which is recognisable from it colourful Georgian buildings which date back to the colonial era. At its heart is the Circus, a plaza modelled after London’s Piccadilly Circus, complete with a Victorian-style clock tower.

While relaxing on the beach or by the pool is undoubtedly a popular activity for holidaymakers on the island, St Kitts also offers plenty of opportunities to get active and explore its unique natural landscape. The Mount Liamuiga volcano hike is listed as one of the most popular activities on the island according to Tripadvisor , offering incredible views from the dormant volcanic mountain.

The island offers a range of hotels and resorts, including budget, family-friendly and luxury options.

One of the top-rated resorts on St Kitts is Timothy Beach Resort in Frigate Bay, which won a Tripadvisor Travellers' Choice Award for 2023.

Related articles

• Cheapest week to book summer flights for 2024
• ‘I explored one of Europe’s prettiest regions without flying’
• Spain’s most walkable city is one of Europe’s sunniest holiday destinations
• UK’s 10 UK worst roads for traffic chaos and there's a clear north-south divide
• 'Lively city' with 'world-class beaches' named best European capital to visit

Would you like to receive news notifications from Daily Express?