Vacations in Dubai

Vacations in Dubai

Search hundreds of travel sites at once for vacation package deals in dubai.

Let KAYAK do the searching

Save on your next vacation

Search and compare hundred of travel sites at once for vacation packages in Dubai

We’re completely free to use - No hidden charges or fees

Filter by free cancellation, free breakfast and more

Cheap Dubai package deals

Most popular dubai flight and hotel deals, all inclusive vacation packages to dubai, last minute vacation packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in dubai, tips for finding dubai package deals.

  • There are loads of types of vacations in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget vacation $462.

Why should you book a vacation package to Dubai?

With a good Dubai vacation package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven

When should you book a vacation package to Dubai?

The winter season in Dubai is the perfect time to take a vacation on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.

Where should you stay in Dubai during your vacation?

For any vacation type in dubai:.

Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.

Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.

For family vacations in Dubai:

The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.

Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.

For romantic vacations in Dubai:

Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.

Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.

For luxury vacations in Dubai:

With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.

The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.

For budget vacations in Dubai:

City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai vacation packages

Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.

Where to stay in Dubai

Dubai vacation information, other popular package vacation destinations.

  • Boston package vacations
  • Bermuda package vacations
  • Saint Lucia package vacations
  • San José del Cabo package vacations
  • Phoenix package vacations
  • Atlanta package vacations
  • Dublin package vacations
  • Saint Thomas Island package vacations
  • Belize package vacations
  • Nashville package vacations

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

  • The Americas
  • The Middle East
  • Asia & South Pacific
  • All Inclusive Offers
  • Athens Vacations
  • Early bird offers

Dubai Vacations

  • Last Minute Escapes

Maldives Vacations

  • Milan Vacations
  • Upgrades & More

Featured Destinations

Middle east.

  • Ras Al Khaimah

Indian Ocean

  • Philippines
  • South Korea
  • South Africa
  • All-Inclusive Vacations
  • Beach Vacations
  • Business Class Vacations
  • Family Vacations
  • Ultimate Luxury
  • Wellness Vacations
  • Egypt - Splendours of the Nile
  • India - Golden Triangle Tour
  • Italy - Milan and Lake Como
  • Jordan - Jordan Explorer Tour
  • South East Asia
  • Sri Lanka - Serendib Explorer
  • COVID-19 Hub
  • Pay My Balance
  • 1-855-358-1505
  • Flight + Hotel

Search Holidays

  • Manage My Booking

Introduction

At a glance, when to visit, what to pack, areas of dubai, attractions.

The speed of Dubai’s metamorphosis is unparalleled, creating a thriving metropolis in the heart of the desert in less than half a century. Many people are likely to be dazzled by the whiteness of the sand and the scale of the skyscrapers, but it’s also still possible to step back in time with a desert safari or boat trip on the creek.

Dubai vacations are even more memorable, when you are soaking up the sun on the beaches of Dubai or enjoying limitless culinary delights in award-winning Michelin starred restaurants, some with awe-inspiring iconic views of the city or watching your sporting heroes take part in some of the most prestigious international sporting events around the year. Alternatively, shop till you drop in any one of Dubai's 96 malls or souks. Be there in Dubai for the vacation of a lifetime.

If you're looking to relax completely, knowing that everything is taken care of even before you travel, we recommend a Dubai all-inclusive vacation! With all your meals and drinks paid for, when you book these offers with Emirates Vacations, you can look forward to a stress-free holiday in the sun.

Book today and enjoy guaranteed savings , low deposits from $199, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Call us on 1-855-358-1505 for further details and to book.

Emirates gateway: Dubai International Airport

Time zone: GMT + 3 hours

Currency: Emirati Dirham. Currency is easily exchangeable beforehand. ATMs are plentiful and credit cards widely accepted

Languages: Arabic, with English is widely spoken

Dialing code: +971

Religion: Islam

Plug sockets: 240 volts AC, 50Hz. British-style plugs with three pins are standard

Transfers from Dubai Airport to Dubai City: 20 to 30 minutes

Transfers from Dubai Airport to Jumeirah Beach/Jumeirah Beach Residence: 40 to 50 minutes

Transfers from Dubai Airport to Palm Jumeirah, Jebel Ali or desert: 50 to 60 minutes

best dubai travel packages

From beaches that fringe the warm waters of the Arabian Gulf bathed in year-round sunshine, to the architectural marvels that punctuate the skyline and define the destination, Dubai is irresistibly dynamic, with some of the world’s most unique and modern attractions.

  • Wander the laneways of the atmospheric gold and spice souks of old Dubai, piled high with aromatic and glittering treats.
  • Check out super-cool Kite Beach if you’re into watersports.
  • Have hours of laughs and squeals while cooling down at Dubai’s water parks.
  • Visit Downtown Dubai, packed with incredible sites, including an actual dinosaur skeleton inside a shopping mall and the highest building on the planet, Burj Khalifa.

Expect year-round sunshine – it’s just a case of exactly how hot you like it. October to April provides the most pleasant option (small potential of rain and wind in January and February), with temperatures around 25-28C. From May, these temperatures really rocket between June and September (upwards of 40C) but Dubai offers plenty of incentives to visit then, such as shopping festivals in air-conditioned malls, indoor attractions and fantastic value offers.

These high temperatures require light, breathable clothing, but always have a cover-up for when you hit the air conditioning. Whilst a liberal and popular holiday hotspot, it’s still good to bear in mind that Dubai is a Muslim destination, so dress respectfully outside of your resort (for example, women should wear clothing that covers the shoulders and the knees in shopping malls, and if entering a mosque, hair must be covered). Desert trips are best in comfortable safari-type clothing.

best dubai travel packages

Palm Jumeirah

This ambitious artificial archipelago, created using land reclamation, was one of many projects that put Dubai on the map, with its crescent-like “fronds” extending out from a “trunk” that runs the length of the central section – all the way from the mainland up to Atlantis The Palm. The 5.4km Palm Jumeirah Monorail also runs from the Gateway Towers at the base to Atlantis The Palm and is home to many thousands of private homes, and numerous hotels by some of the world’s leading brands, such as Fairmont, Sofitel, Jumeirah, One&Only, Waldorf Astoria and Anantara.

best dubai travel packages

Jumeirah Beach

One of the original homes of tourism here in the emirate, Dubai’s main beach area is washed by the warm waters of the Arabian Gulf and lined with excellent hotels, such as the iconic wave-like Jumeirah Beach. Also here is Wild Wadi WaterparkTM, which will keep everyone amused for hours, while Jumeirah beach park is a great public space that’s also popular with local families.

Downtown Dubai

The anchor of this futuristic district is the Burj Khalifa, the world’s tallest building, which took five years to build and opened in 2010, boasting a staggering 828 metres to its name; from the viewing area at its upper levels, other buildings below seem like crumbs. Inside the Burj Khalifa is the first-ever Armani hotel, while other attentiongrabbing attractions of this area include Dubai Mall and Dubai Fountain - both the world’s biggest - where jets of water shoot up to 150 metres high, and seem to “dance” in time to music as they are illuminated by more than 6,000 lights.

best dubai travel packages

Sitting on the south side of Dubai Creek, the oldest part of the city dates to the 1900s, with sandy-coloured buildings, museums and minarets. Here you’ll see Al Fahidi Historical Neighbourhood with its charming car-free, narrow streets and houses topped with wind towers, or barajeel. The area was previously known as Bastakiya after the Iranian town of Bastak, where the original Iranian settlers came from across the Gulf to take advantage of free land and low taxes. You can find out more about Dubai’s history with a look inside Dubai Museum or browse the rainbow of fabrics, clothes and slippers in the Textile Souk.

Sheikh Zayed Road

Named for the much-revered first president of UAE, this is where life has spread out to from the Creek, and has been the epicentre of development, amassing a collection of skyscrapers each more audacious than the next, such as Emirates Towers. Technically, it’s just part of the highway running across the whole of UAE, but it’s also where you’ll find many of the city’s hotels, restaurants and shops. For example, just some of the junctions off here will take you towards Mall of the Emirates, Gold & Diamond Park, Madinat Jumeirah, Burj Al Arab, Wild Wadi Water Park™, Downtown Dubai, Burj Khalifa, Dubai Mall and Dubai Marina.

best dubai travel packages

Wander one of the city’s oldest districts, dating to around 1841. Once just a sleepy waterside village, Deira soon took over the original settlement of Bur Dubai in scale and is still a cornucopia of ethnicities mixed with tourists, here to check out the souks, where gold is among the cheapest in the world. You can cross Dubai Creek between Deira and Bur Dubai in an ‘abra’ (water taxi) for just AED2 (approximately 40p).

Dubai Marina

Sophisticated, skyscraping, and buzzing – Dubai Marina is designed to evoke Riviera-style living in a contemporary setting. This attractive and central place to play and stay in Dubai is a waterfront development built around a 3.5km canal. Along its banks are Dubai Marina Mall (with around 140 stores); The Address Dubai Marina hotel; Pier 7 Dubai Marina - which boasts seven restaurants, each on its own floor and with a unique atmosphere; and Dubai Marina Yacht Club.

best dubai travel packages

Mall of the Emirates/Al Barsha

Now 11 years old, this place changed the face of shopping in Dubai forever. Billed as the world’s first shopping “resort”, it is a destination in its own right, home to Ski Dubai, hundreds of shops, two hotels including Kempinski Mall of the Emirates, Magic Planet for family entertainment, a 14-screen VOX Cinema, Dubai Community Theatre and Arts Centre and more than 90 dining options. Al Barsha the residential area surrounding the mall offers affordable accommodation and local dining options close to many of Dubai’s key attractions.

No trip to Dubai would be complete without a desert safari. Hop into a 4x4 and leave the city behind as you head into the wilds of the desert - go dune ‘bashing’ or camel-riding before sunset, then enjoy remote Bedouin-style camps with fireside tales and delicious dinners, or even spend the night sleeping out in tents before returning to Dubai after breakfast.

best dubai travel packages

Jumeirah Beach Residences

This area combines casual outdoor living with top-notch shops, restaurants and the beach. The Walk at JBR, which was Dubai’s first outdoor promenade, has a 1.7km stretch of shops and restaurants and more recently has also been joined by The Beach, with even more dining and leisure options formed around a pedestrian esplanade.

Jebel Ali is the thriving commercial port area of Dubai, around 35km southwest from the city, and given its historic establishment, can also boast one of the most longstanding and largest resorts in the emirate – the JA Jebel Ali Beach Resort, which has a lovely private beach, golf course and a myriad of other leisure attractions. Jebel Ali is also the new home of a dazzling new attraction - Dubai Parks & Resorts. This is the first integrated resort destination in the region, opening in late 2016, and home of LEGOLAND® Dubai, LEGOLAND® Waterpark, motiongate™ Dubai and Bollywood Parks™, as well as Riverland™.

best dubai travel packages

International restaurants and top global chefs are in abundance, but if you want to try Emirati cuisine, you’ll sense a range of regional influences. Most likely, you will find roast lamb with rice and nuts (ghuzi), stuffed vine leaves (warak enab), chickpea and sesame paste (hummus), bulghur wheat with mint and parsley (tabbouleh), spit-cooked meat in pitta bread with garlic sauce (shawama), cooked balls of chickpeas with herbs (falafel) and plenty of fish. Goat may also be on the menu, but no pork, in accordance with Muslim beliefs. Alcohol is tolerated and drinking is possible in the plentiful hotel bars and restaurants.

Culture in Dubai is rooted in Islamic traditions. Emirati men tend to dress in traditional dishdasha or khandura (long white shirt-dress), with ghutra (a white headdress) and agal (a rope worn to keep the ghutra in place), while women tend to wear an abaya (a long black cloak), with a sheyla or hijab (a scarf used to wrap around the face and head). The most religious time of the year is Ramadan, when Muslims fast for approximately a month and a festival atmosphere can be found in the evening when the locals break their fast. But as well as the minarets of mosques, you will also see temples and churches. A new opera house is also set to open this year.

best dubai travel packages

Hares and lizards - such as the spiny-tailed lizard - may scamper around the desert but you would be hard pushed to see much natural wildlife in Dubai these days. However, there are many excellent reserves and conservation projects you can explore – which provide the thrill of seeing the iconic oryx, an Arabian leopard, mountain gazelle, sand gazelle or caracal. In the waters, you might have the chance of spotting the biggest fish of the ocean, a whale shark.

best dubai travel packages

The human history of Dubai dates back to the bronze age (2500BC) when nomadic cattle herders are first thought to have settled in the area. A couple of millennia later and Dubai was still little more than a small fishing settlement until members of the Bani Yas tribe, led by the Maktoum Family, settled at the mouth of the creek in 1833. The creek was a natural harbour and Dubai soon became a centre for the fishing, pearling and sea trade. The population was later buoyed by the lure of tax-free living attracting traders from the Indian subcontinent. Oil was discovered in the 1950s and the first cargo left Dubai in 1969. In 1971, the six emirates agreed a Federal Constitution, gained independence from Britain becoming the United Arab Emirates, with Ras Al Khaimah joining the following year to form the UAE as it is today.

best dubai travel packages

Aquaventure Waterpark

This adrenaline-pumping waterpark set within Atlantis The Palm includes the chance to take the Leap of Faith or zoom through the darkened tunnels of Shark Attack; as well as an invite to tackle Aquaconda, the world’s largest water slide. Or, perhaps you prefer to just sit and mind everyone’s towels as you relax on 700 metres of private beach. Ticket prices from E£ 1,253 per person.

At The Top, Burj Khalifa

This attraction is spread across levels 148 and 125 of Burj Khalifa, the world’s tallest building. The experience starts with the lift up to level 125, where you can marvel at the view from the 380-degree enclosed observatory. Then it’s up a little more, to the 148th floor at 555 meters, where you step onto the world’s highest outdoor observation deck. After all that sightseeing, visit Level 122 which is home to the restaurant and bar, At.mosphere. Ticket prices from E£ 797 per person.

IMG Worlds of Adventure

Dubai’s first mega themed entertainment destination will be the largest temperature controlled indoor park in the world and will wow guests with its four epic adventure zones. Two are created with global adventure brands Cartoon Network and MARVEL, while IMG Boulevard and the Lost Valley – Dinosaur Adventure are original concepts from the IMG Group. Think rollercoasters, thrill rides and attractions – all based on popular characters and hair-raising dinosaurs. Combine with the amazing array of retail temptations and exclusive dining venues and you have a day of fun for the whole family.

The brilliant KidZania® is a super-interactive and educational attraction inside The Dubai Mall where children play grown-ups as they try on various careers for size. There are more than 80 roles to choose from including firefighters, radio hosts, jewellery designers and mechanics. Ticket prices from E£ 683 per person.

Wild Wadi Waterpark™

One of the best family days out in Dubai, Wild Wadi Waterpark™ is set in front of the iconic Burj Al Arab Jumeirah, and offers 30 watery rides and attractions. Themed around the tale of Juha, a character from Arabian folklore, the rides range from sedate “lazy rivers” where you can bob along in a rubber ring, to the Jumeirah Sceirah, which has two tandem slides you zip down from a 32 metre high tower.

Dubai Aquarium

The 270-degree acrylic walkthrough tunnel takes you under one of the largest tanks in the world so you can see some of the 33,000 animals - representing more than 85 species including 400 sharks and rays. You can also just stroll past it from The Dubai Mall, with one of the world’s largest viewing panels to gaze through to the aquarium. Ticket prices from E£ 456 per person.

Seawings Seaplane Tours

There’s only one way to really get to grips with the scale of things here - from the air and these tours by seaplane do just that. Giving the finest views over Dubai, these comfortable little planes can use 27 different water landing strips and runways across UAE, so any combinations can be arranged. The 40-minute Dubai Silver Air Tour flies you over all the Dubai classics, taking off from either Dubai Creek or Jebel Ali Resort, then cruising along the coastline, giving you a bird’s-eye view of The World, Burj Khalifa and Burj Al Arab Jumeirah. Ticket prices from E£ 8,109 per person.

Situated within the Mall of the Emirates, this made the world sit up and take notice of Dubai’s many ambitious projects when it first opened – and still does. It was the Middle East’s first indoor ski resort and today offers a snow park, Ski School, Penguin Encounter and Snow Bullet. Ticket prices from E£ 615 per person.

SEGA Republic

One of the many attractions inside The Dubai Mall, SEGA Republic is a high-adrenaline, indoor family theme park, featuring 15 attractions and more than 170 games, from cutting-edge motion simulators to virtual experiences. Ticket prices from E£ 820 per person.

Dubai Parks and Resorts

Calling all adventure seekers, Dubai Parks and Resorts opened its doors in October 2016 and should be at the top of your must-visit list. Home to three world-class theme parks, one water park and over 100 attractions ranging from rollercoasters and waterslides to cinematic rides and live shows, Dubai Parks and Resorts is sure to delight guests of all ages. Lapita, a four star Polynesian style hotel is located within the parks and offers guests the convenience of a night’s rest only a few minutes from the rides. Located on Sheikh Zayed Road, opposite Palm Jebel Ali, a trip to this fun-filled resort is a great option for guests staying in Dubai or Abu Dhabi.

More To Discover

If you want to do more than “fly and flop”, you’ve come to the right place. One way to get the measure of Dubai is to catch it from the air – whether that be via an adrenaline-fuelled skydive over The Palm Jumeirah, or a scenic seaplane ride. Other aerial options include a sunrise hot air balloon experience, which will lift you off the ground 1,200 metres above the desert as you spot oases and the occasional wandering camel below. Kite surfers will love Kite Beach, one of Dubai’s best stretches of sand, and one where watersports operators aplenty await to help you pick up a new skill or hone your talent. Meanwhile at Dubai Mall, you can try a snorkeling cage experience within the huge tank at Dubai Aquarium, or even swim with sharks.

Explore more Indian Ocean Holidays

best dubai travel packages

Mauritius Vacations

best dubai travel packages

Seychelles Vacations

best dubai travel packages

Sri Lanka Vacations

Join the emirates vacations community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Vacations?

  • Personalised holidays
  • Support at every step
  • Get more for your money
  • Fly Better with Emirates

For more information, please click here

  • Recent Hotels 0 You do not have any recently viewed hotels.
  • Shortlist 0 Your hotel shortlist is empty!
  • Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

best dubai travel packages

Dubai Vacation Packages

Where to stay.

Experience more and spend less with Vacations by Marriott.

JW Marriott Marquis Hotel Dubai

Book a 5-star hotel getaway in downtown dubai, grosvenor house, a luxury collection hotel, dubai, the ritz-carlton, dubai, the westin dubai mina seyahi beach resort & marina, discover our private beach resort in dubai marina, habtoor grand resort, autograph collection, the perfect beach escape location for leisure at jbr., w dubai - the palm, hit escape at dubai's most iconic beach resort, le méridien dubai hotel & conference centre, seek out adventure from our 5-star congress hotel, le méridien mina seyahi beach resort & waterpark, discover our 5-star hotel on the beaches of dubai, dubai marriott harbour hotel & suites, reserve your stay at our 4 star hotel in dubai marina, sheraton dubai creek hotel & towers, experience life at the creek from our 5-star hotel, lapita, dubai parks and resorts, autograph collection, experience our unique hotel within dubai parks and resorts, sheraton grand hotel, dubai, reserve your stay at our 5 star hotel in dubai, explore the world.

best dubai travel packages

best dubai travel packages

Deals on vacations and trips to Dubai

Save when you book dubai package deals.

I only need accommodations for part of my trip

best dubai travel packages

Search vacation packages deals in Dubai's top destinations

Jumeira Beach and Park featuring a beach as well as a small group of people

Dubai flight + hotel vacation packages

Address Beach Resort

Address Beach Resort

Address Dubai Mall

Address Dubai Mall

Armani Hotel Dubai

Armani Hotel Dubai

Address Sky View

Address Sky View

Palace Downtown

Palace Downtown

Top dubai hotels deals.

Atlantis, The Palm

Atlantis, The Palm

Le Meridien Dubai Hotel & Conference Centre

Le Meridien Dubai Hotel & Conference Centre

JW Marriott Marquis Hotel Dubai

JW Marriott Marquis Hotel Dubai

Premier Inn Dubai International Airport

Premier Inn Dubai International Airport

Millennium Place Marina

Millennium Place Marina

Shangri-La Dubai

Shangri-La Dubai

Popular places to visit, burj khalifa.

After visiting Burj Khalifa, make a plan to see the other sights and activities in Dubai. Stroll along the riverfront or visit the shops in this vibrant area.

You can browse for souvenirs with a trip to Dubai Mall, a popular shopping spot in Dubai. Wander the riverfront in this vibrant area.

Marina Beach

Nothing says vacation like spending a lazy day at Marina Beach, a popular beach in Dubai. Stroll along the marina or attend a sporting event in this family-friendly area.

Frequently asked questions

  • Popular vacation destinations in Dubai
  • All inclusive vacations
  • Hatta Vacations

Top all inclusive vacation packages with airfare

  • Las Vegas All Inclusive Vacation Packages with Airfare
  • Punta Cana All Inclusive Vacation Packages with Airfare
  • Cancun All Inclusive Vacation Packages with Airfare
  • Cabo San Lucas All Inclusive Vacation Packages with Airfare
  • Hawaii All Inclusive Vacation Packages with Airfare

Book a vacation to Dubai

Most popular, additional information about expedia group.

best dubai travel packages

Dubai Vacation Packages

Book a stay + flight or car to save on your vacation package.

I only need accommodations for part of my trip

Top places to visit in Dubai

Jumeira Beach and Park featuring a beach as well as a small group of people

Experience Your Best Dubai Vacation

Dubai, in the United Arab Emirates, features a wealth of experiences in a single city. With its glamorous high-rise shopping malls, ancient traditional villages, relaxing beaches, and amazing natural scenery, Dubai caters to every type of vacationer.

Explore the natural inland desert of the Dubai Desert Conservation Reserve by camel, and watch the sun set over the sand dunes. Ride the elevator to the top of the Burj Khalifa, the tallest building in the world, and look down upon the teeming city spread beneath you. Book discount flights, tours, car rentals, and more with Orbitz.com, and get ready to explore all of the exciting attractions of Dubai, one of the most fascinating destinations in the Middle East.

Best time to take a trip to Dubai

Dubai is hot and humid most of the year, but temperatures become a bit more tolerable between October and April. If you love to shop, the Dubai Shopping Festival in February may be a good time to go, but book your trip early because hotels fill to capacity during this time. Avoid Dubai in July and August, when temperatures can rise up to 120 degrees Fahrenheit. Most businesses in Dubai close or have limited hours during the Muslim holiday of Ramadan, so you might want to avoid Dubai during this time. Ramadan's dates change each year based on the Islamic calendar.

Insider tips for Dubai travel

Mall of the emirates.

Ski and shop at this gargantuan mall that features its own indoor ski slope and over 500 shops.

Al Dhiyafah Road

Dine with the locals who built Dubai on this road filled with curry shops and grilled meat vendors.

Yalumba Friday Brunch

Show up at Yulumba restaurant in the Le Meridien Hotel on Friday for an over-the-top brunch with free-flowing champagne and mountains of food.

Al Mansour Dhow

Enjoy a classic Arabic buffet while gently floating along Deira Creek on this dinner dhow cruise.

Aquarium Night Tour

Dubai Aquarium's Underwater Zoo offers night tours that let you catch a glimpse of the creatures usually hidden in the dark.

Things to do in Dubai

Dubai museum.

This museum houses artifacts from the archeological sites of Al Sufouh and Jumeirah, including pieces dating back to the third century.

Bastakia Quarter

Ancient buildings transformed into modern art galleries characterize this small neighborhood that is a must-see for art lovers.

The Dubai Fountain

Watch as the water shoots up taller than a 25-story building in this daily water show on Burj Khalifa Lake.

Jumeirah Beach

Relax, sunbathe, or swim during the day, and watch the sunset while enjoying a barbecue on the sand in the evening.

The Sheikh Mohammed Centre for Cultural Understanding

Enjoy a mosque tour, cultural breakfast, or historic walking tour with this center that offers programs for all ages.

Dolphin Bay

Swim with the dolphins at this bay affiliated with the Atlantis Hotel and interact one-on-one with these incredible creatures.

Emirates Golf Club

Tee off at one of the finest golf courses in the world, which hosts the Dubai Desert Classic each year.

Souk Madinat Jumeriah

This entertainment complex features a traditional Arabian market, meandering canals, and a marina with incredible views.

Wild Wadi Water Park

Enjoy the wave pool or give yourself a thrill on one of the speedy water slides at this water park.

Jumeirah Mosque

This gorgeous mosque is the largest in the city and the only one in Dubai open to non-Muslims.

Top Dubai vacation package deals

Address Beach Resort

Address Beach Resort

May 17 - may 23, dallas (dfw) to dubai (dxb), dubai (dxb) to dallas (dfw).

Riu Dubai Beach Resort - All Inclusive

Riu Dubai Beach Resort - All Inclusive

Reviewed on Jan 20, 2024

The Biltmore Hotel Villas

The Biltmore Hotel Villas

May 29 - jun 4.

Palace Downtown

Palace Downtown

Reviewed on Nov 28, 2022

Radisson Resort Ras Al Khaimah Marjan Island

Radisson Resort Ras Al Khaimah Marjan Island

May 22 - may 29, new york (jfk) to dubai (dxb), dubai (dxb) to new york (jfk), top rated hotels for your dubai vacation package.

Atlantis, The Palm

Atlantis, The Palm

Le Meridien Dubai Hotel & Conference Centre

Le Meridien Dubai Hotel & Conference Centre

JW Marriott Marquis Hotel Dubai

JW Marriott Marquis Hotel Dubai

More trip options.

  • Select vacation destinations in Dubai
  • More to explore for Dubai
  • Hatta Vacations

Additional information about Expedia Group

  • 1800-123-5555
  • Travel Agent? Join Us

Get Travel Triangle in your pocket.

Get your app via sms

Honeymoon Packages

  • Family Packages
  • Holiday Packages
  • Holiday Deals
  • Luxury Holidays
  • Destination Guides
  • Holiday Themes
  • Plan My Holiday

Indian Destinations

  • Uttarakhand

International Destinations

Tour Packages

  • Switzerland

Honeymoon Packages

  • Sikkim - Gangtok - Darjeeling
  • South Africa

Destination

Seasonal Packages

Adventure

  • Water Activities

Religious

Dubai Tour Packages

Tour Packages

  • International
  • Middle East

Dubai Holiday Packages : rated 4.5 /5 (based on 3211 reviews) | Packages starting from ₹13,999/-

Dubai Holiday Packages

With the expansive stretches of glimmering coastline set against the backdrop of a city that knows how to live a good life, our Dubai packages from India understand everything that you need and more. Whether you seek cultural immersion or budget-friendly options, our tour packages to Dubai cater to diverse preferences, making your journey an enriching and personalised adventure. We are proud to have an itinerary that is perfect for every kind of traveller, ensuring an unforgettable experience with our Dubai travel packages . Explore the beauty and luxury of Dubai with our meticulously crafted Dubai holiday packages , designed to suit your every vacation need.

Dubai is often dubbed as a budget destination for Indian travellers, and for those who want to escape for an international vacation, our tailored itinerary, including the Dubai trip cost from India , can be the best option for their journey. Planning a Dubai vacation can be a seamless experience when considering our diverse range of travel packages that cater to different lengths of stay and varied explorations within the marvellous city. Whether you are planning a long-stay trip that will take you through the city or a short Dubai tour to capture a glimpse of the culture, we can help you find the best package for Dubai.

15 Best Tourist Places To Visit In Dubai Tour Package

Segregated into numerous sections basis their city landscape, Dubai comprises Deira Dubai, Bur Dubai, Sheik Zayed road, Inner suburbs, Jumeirah, Dubai Marina, The Palm Jumeirah, Burj Al Arab and other nearby areas, such as Sharjah, Hatta and Abu Dhabi. Having their own charm, each segment is worth the visit while you hop on to this exotic destination with our tour packages for Dubai from India. The presence of architectural marvels like the world's tallest man-made structure the Burj Khalifa and the only seven-star hotel in the world - Burj Al Arab built on an artificial island are some of the most striking features to be included in the itineraries of Dubai holiday packages that entice vacationers worldwide.

Some of the best tourist attractions that are a part of the majority of these Dubai packages are mentioned below:

1. Burj Al Arab

What’s Special: Third tallest hotel, Luxurious hotel

Nearby Attractions: Madinat Jumeirah, Palm Jumeirah

Timings: 12:00 PM to 6:00 PM

Major Attractions: Abu Dhabi, Sharjah

Distance From City Center: 21.3 km

For a luxurious experience, enjoy a sojourn in the third largest tower in the world, Burj Al Arab. A 56-floor building, this world-class hotel is equipped with all the amenities that make the travel experience a grand affair. Housing a wide range of rooms, bars and restaurants, where one can also enjoy the breathtaking panoramic view of the city, which is blissful.

2. Dubai Miracle Garden

What’s Special: Largest natural flower garden

Nearby Attractions: Sharjah Museum of Islamic Civilization, Sharjah Art Museum, KM trading shopping center, Sharjah Calligraphy Museum, Sharjah Heritage Museum

Timings: 9:00 AM to 9:00 PM

Major Attractions: Al Ain, Ajman

Distance From City Center: 23 km

One of the most alluring tourist attractions, a visit to the Miracle Garden leaves everyone with a tingling sensation. Stop by this extremely beautiful place, and enjoy the visual treat of this largest flower garden in the world having more than 109 million flowers to cherish, which is beguiling.

3. Dubai Mall

What’s Special: World’s biggest indoor aquarium

Nearby Attractions: Burj Khalifa, Souk Al Bahar

Timings: 10:00 AM to 11:00 PM

Major Attractions: Olympic sized Ice Rink, 250 room luxury hotel, SEGA indoor theme park, More than 120 restaurants

Distance From City Center: 8 km

One of the most luxurious malls in the world is the Dubai Mall, the grandeur of which will make one fascinated. It has almost all the top-notch and luxurious brands with unlimited dining options. There are loads of activities for entertainment purposes.

What’s Special: Traditional markets

Major Attractions: Spice Souk, Gold Souk, Seawings, Dubai Dolphinarium

Distance From City Center: 9 km

A melting pot of many nationalities, Deira is famed for its traditional markets that are bustling with shoppers throughout the day. Encompassing Gold Souk (market), one can buy some amazing traditional jewellery from the largest gold market in the world. And, its Spice Souk has numerous stalls where one can buy bags of cumin, paprika, saffron and other spices along with rose water and incense.

5. Mall of the Emirates

What’s Special: Unique amusement areas, Ice cream parlour

Nearby Attractions: Souk Madinat Jumeirah, Ayyam Gallery, The Emirates Golf Club

Timings: 10:00 AM to 12:00 AM

Major Attractions: Ski Dubai, Go Sport, Magic Planet

Distance From City Center: 10 km

This is a one-stop destination for all your needs of food, fashion, and entertainment. From high-end luxurious brands to different cuisines and entertainment options like Ski Dubai and penguin exclosure, it is just a perfect place to visit on your trip to Dubai.

6. Burj Khalifa

What’s Special: Highest outdoor observation deck

Nearby Attractions: Dubai Mall, Dubai Fountains, Souk Al Bahar

Timings: 24 hours

Major Attractions: Observation deck, hotel, restaurants, swimming pool

Distance From City Center: 13.7 km

Visit the tallest building in the world with a Dubai tour package with airfare. The building was inaugurated in the year 2010, it is one of the major attractions of Dubai. See the panoramic views of Dubai city from the 124th floor of Burj Khalifa. The place has the second largest fountain in the world where you will witness 6,600 lights illuminated. The interiors and exteriors of Burj Khalifa both are spellbinding and mystical. On a Dubai package without flight explore this mesmerizing landmark of Dubai.

7. Jumeirah Beach

What’s Special: Man-made beach

Nearby Attractions: Tao Spa, AquaFun, Wild Wadi Waterpark

Timings: 7:30 AM to 10:00 PM

Major Attractions: Art Gallery, Wild Wadi Waterpark, WOW Kids Amusement Arcade

Distance From City Center: 18.6 km

If you think that Dubai is only about extravagant malls and man-made skyscrapers, then you are highly mistaken as this place is also adorned with so many wonderful beaches, and the best of them is Jumeirah Beach. Make sure to include an excursion to Jumeirah Beach in your Dubai trip plan to enjoy mesmerizing sunset and thrilling watersports.

8. Wild Wadi

What’s Special: Waterpark

Nearby Attractions: Burj Al Arab, Dolphin Bay

Timings: 10:00 AM - 6:00 PM

Major Attractions: 17 water slides, 3 pools

Distance From City Center: 11.8 km

Another adventurous place to visit in Dubai especially with kids is Wild Wadi. It is an amusement park with so many different and adventurous rides. The rides here are suitable for both kids as well as adults. Wild Wadi is located in front of the Burj Khalifa.

9. Global Village

What’s Special: Street entertainment, stage shows, Circus

Nearby Attractions: Dubailand, Dubai Sports City, Dubai World Cup

Timings: Saturday to Wednesday - 4 PM to 12:00 AM; Thursday, Friday, and public holidays - 4 PM PM to 1 AM

Major Attractions: 31 Pavilions

Distance From City Center: 14.8 km

If you happen to be in Dubai anytime between November to March, then do not forget to visit Global Village for an ultimate recreation. The place is lit with artists from all over the world showing their respective art, craft, and culture. It is a great place for shopping, having food and fun-filled family time.

10. Dubai Aquarium & Underwater Zoo

What’s Special: Shark feeding encounter

Nearby Attractions: Dubai Mall, Souk Al Bahar, Burj Khalifa, Dubai Fountain

Major Attractions: 300 species of marine animals; Underwater tunnel

Distance From City Center: 750 meters

Dubai Aquarium & Underwater Zoo is one of the most amazing places to visit on your trip to Dubai. Whether you are travelling with your family or friends, there is no doubt that it will be an enthralling experience. There is an underwater zoo, moreover, one can also explore through glass bottom boats. Some of the experiences that one can indulge in are shark encounters, cage snorkelling, shark diving, shark walker, etc.

11. Dubai Marina

Nearby Attractions: Dubai Marina Mall, Dubai Marina Walk

Major Attractions: Burj Khalifa, Souk Al Bahar

Distance From City Center: 13.8 km

The area from Al Sufouh Road to Dubai Media City forms Dubai Marina. Jumeirah Beach Residence along with the beach also falls under this area. There are many attractions that one can spot in Dubai Marina. Some of the places that you can easily travel to are Dubai Marina Mall and Dubai Marina Walk.

12. Sand Dunes

What’s Special: Dune bashing; Desert Safari

No trip to Dubai is ever complete without a desert safari. Explore the expanse of golden sand and majestic camels. One can choose from jeep safari and camel safari, but no matter what you end up choosing, it will be a surreal experience. Moreover, one can indulge in fun activities such as jeep racing, dune bashing, etc. One can also opt to camp for the evening and witness cultural activities.

13. Dubai Fountain

What’s Special: Choreographed fountain system

Nearby Attractions: Burj Khalifa, Dubai Aquarium and Underwater Zoo

Timings: 7:00 AM to 11:00 PM

Major Attractions: Fountains

Dubai Fountain is an amazing option to visit on any evening. Here, one can witness Lake Ride and Boardwalk. Broadwalk is a floating area within the fountain that allows people to witness the light fountain show up close. On the other hand, the Lake ride takes you on a spectacular journey to Burj Lake.

14. Kite Beach

What’s Special: Kite surfing

Nearby Attractions: Jumeirah beach park; Safa Park; Ayyam Gallery; Popeye Jetski

Timings: 10:00 AM to 12:00 AM (Thursday, Friday, Saturday); 10:00 AM to 10:00 PM (Sunday, Monday, Tuesday, Wednesday)

Major Attractions: Beach, Mini Library

Distance From City Center: 15.7 km

Kite Beach is an ideal place to visit if you wish to partake in water sports activities. Some of the activities that you can indulge in here are kitesurfing, wakeboarding, stand-up paddleboarding, windsurfing, cruising, parasailing, etc.

15. Dubai Creek

What’s Special: Cruise

Nearby Attractions: Glow-in-the-Dark Hole Mini Golf; iFly Dubai Indoor Skydiving

Distance From City Center: 9.6 km

Just as the name suggests, Dubai Creek is a saltwater creek. It is apt to opt for a cruise trip and explore the charms of Dubai from afar, savour a delicious meal, and at the same time witness the incredible skyline of Dubai.

Best Dubai Packages From Top Cities Of India

Check out exclusive holiday tours such as Dubai packages from Delhi , Dubai packages from Mumbai , Dubai packages from Bangalore , Dubai packages from Hyderabad , Dubai packages from Chennai .

What is the Best time to take a tour of Dubai?

With a bounty of customizable holiday packages to choose from, Dubai often tops the list of the best travel destinations. Offering a myriad of exciting experiences, this vibrant city is frequented by families, couples, explorers, adventure enthusiasts, and almost every kind of tourist throughout the year. The best time to visit Dubai is from November to April, when the weather is cool and pleasant. The months of January and February witness a huge number of tourists flocking to the city while booking Dubai travel packages , for the city observes the famous festival, like the Dubai Shopping Festival, and conducts popular events, such as the Dubai Global Village fair during this period, adding even more excitement to the whole journey. Planning your Dubai trip during these festive months ensures an immersive experience in the city's vibrant culture and dynamic events.

Now, let’s just take a quick glance at the below segregation of the weather based on season, so as to help you decide on the best time to explore the skyline of the city of Dubai. Explore our exclusive Dubai packages , designed to enhance and enrich your travel experience in this bustling metropolis.

Summer Season (June - August)

As the city experiences the temperature hitting 40-degree and 50-degree celsius during the summer season, it is often advised to avoid visiting Dubai in the months of June and August. With the scorching heat and humid weather, exploring the skyscrapers, partaking in an outdoor activity, or lazing along the beaches do not seem exciting. Moreover, as Ramadan is also observed at this time of the year, you might not find any cafe or restaurant to serve you.

Shoulder Season (April - May, Sept - October)

However, you may choose to get on a tour to Dubai in the months of April, May, September, and October, which come under the shoulder season. Though the climate is hot, with the average temperature hovering around 28-degree celsius, the weather is quite good for swimming and other activities. As the accommodations are easily available at discounted rates, this duration can also be a good time to enjoy a vacation under budget. To get the benefit of discounted rates book a  Dubai package with flight during the shoulder season.

Peak Season (November - March)

With the onset of the winter season, here comes the best time to book Dubai holiday packages . As the temperature ranges between 17-degree and 30-degree celsius, you may enjoy a perfect getaway along the spectacular beaches and indulge in other outdoor activities. So, book one of our Dubai tour packages from India , and get ready to enjoy a stroll along the Persian Gulf’s white sands to pamper your senses. However, as it is the peak season, and you might witness a huge flock of tourists visiting the destination at this time, it is recommended to make your hotel reservations months in advance.

What are the best ways to travel in and around Dubai?

While the spectacular city beckons you to enjoy your next vacation in the midst of skyscrapers and golden sands, you must also be wondering how to get to Dubai from India. So, let’s have a sneak peek at the below information that is not a constraint to the travel modes available from Dubai to India but also helps you know how you can travel in and around the city without any hassle. Exploring Dubai is made easier with our diverse tour packages to Dubai , ensuring an unforgettable and seamless experience in this mesmerising city.

How to Reach Dubai?

Opting for an air route is, undoubtedly, the best way to reach Dubai from India. To travel to the city of skyscrapers, all you need to book a flight of your choice basis time and budget, and voila! You are all set to cover the aerial distance of about 2204 km in a span of time as short as 3 hours 25 minutes. Housing the world's busiest airport, Dubai International Airport is the largest emirate in UAE (United Arab Emirates) is well-connected to its cities and other parts of the world. And, if you are traveling from India, then you may choose from a plethora of direct and connecting flights, such as Indigo, SpiceJet, Air India, and others apart from the Emirates National Airlines that connects the two places. So, book a Dubai tour package from Mumbai, Delhi, Bangalore, Hyderabad, Chennai, Amritsar and other cities of India, and get ready to have an incredible experience that the vibrant city has in store for you. 

How to Commute Around Dubai?

Once you reach the majestic city of Dubai, you may choose to book either a limousine for a luxurious experience, or you can get on a bus via Dubai tour bus packages , which is the cheapest mode of transport to explore the Sheikh city. With good network connectivity to all other emirates of UAE, the Road Transport Authority of Dubai runs several buses between Dubai, Abu Dhabi, Ajman, and Masafi amongst others, making it quite a smooth journey for visitors. However, it is advised to avoid traveling during peak hours, else you might just end up getting stuck in the traffic.

5 Best Beaches In Dubai

Don’t forget to visit these popular beaches on your next Dubai tour. Exploring these stunning beaches is made convenient and enjoyable with our exclusive Dubai travel packages , offering a comprehensive and delightful experience in this vibrant Emirati city.

1. Jumeirah Public Beach

Catch the true vibe of Dubai at Jumeirah Public Beach as this is the place from where beach-hopping starts. Being one of the oldest beaches in Dubai, the place offers a true window to the day to day life in Dubai. You can also indulge in numerous water sports activities.

2. Kite Beach

If you wish to encounter the best experiences of water sports adventure sports in Dubai then Kite Beach is certainly an awesome place for you to visit on your Dubai tour. You can enjoy wakeboarding, paddleboarding, and kitesurfing here and the jogging track is nearly 14 km long and offers fascinating views of the Burj Al Arab.

3. Al Mamzar Beach Park

Al Mamzar Beach Park is amongst the most popular public beaches in Dubai and features exotic beauty with over a thousand palm trees lined up symmetrically to break the monotonous view of skyscrapers. The beach park has barbeque stations, picnic sites, and numerous activities that make your day truly awesome.

4. Ghantoot Beach

Ghantoot Beach is amongst the most mesmerizing beaches in Dubai. Being a private beach, the impeccable beauty of this beach is spellbinding. The beach is taken care of by the Golden Tulip Al Jazira Hotel and hosts numerous water sports adventures including jet skiing, wakeboarding, and kite surfing.

5. Mercato Beach

Mercato Beach is truly a hidden gem in the bustling city life. The place is known for its tranquil ambience and is ideal for peace seekers and nature admirers. It is located opposite Mercato Mall where you can head to grab delicious delicacies. The beach features beautiful sunset and sunrise and you can enjoy an evening walk with your significant other on your Dubai honeymoon tour.

Once you have decided on a suitable time to embark on a wonderful excursion to the city brimmed with magnificent landmarks, browse through our list of well-curated packages, including a tour itinerary that ensures a planned and hassle-free vacation. The tour itineraries are specially crafted to fulfil all the necessary requirements of a traveller. From full-fledged sightseeing tours to adventurous outdoor activities and luxurious accommodations to swift local transfers, these itineraries have been designed with an endeavour to offer you a journey worth being remembered for. After selecting the package that suits your requirements, the Dubai trip cost from India will depend on the customised itinerary. Explore our diverse range of Dubai Holiday Packages for an all-encompassing and delightful experience in this thriving metropolis.

Hence, irrespective of whether you are an adrenaline-junkie, beach lover, or just an explorer, there is something for every one of you. What’s more? When you can avail a Dubai package at a price that doesn’t burn a hole in your pocket, there is no reason to procrastinate an excursion to this oasis of enticing experiences. So, just pack your bags for a vacation in the city of Sheikhs, and get ready to sail through mesmerizing landscapes. For, here is a perfect retreat awaiting you!

There are a plethora of tour packages  that we provide packages for. Check out the link below for more info.

Scroll through the curated list of holiday packages for Dubai, and get an idea of what a tour to this exotic tourist destination has to offer to its visitors.

Bestselling Dubai Tour Packages

Shortlisted Packages

  • No packages to compare. Please add using ‘Add to compare’ button.
  • Select at least two packages

Duration ( in Days )

Budget Per Person ( in Rs. )

Hotel Star Rating

Showing 153 Dubai Tour Packages

Enlivening Dubai Package

Best Selling Dubai Tour Packages For A Lavish Excursion

₹ 27,500/- ₹ 30,119/-.

Per Person on twin sharing

  • Ideal for families
  • Desert Safari
  • Sightseeing

Hotel included in package:

Upto 3 Stars

Best Selling Dubai Package With Ferrari World

Most Reasonable Dubai Packages For A Cherishable Vacation

₹ 30,399/- ₹ 33,946/-.

  • Best-Selling
  • Ferrari World
  • Best sellers
  • Burj Khalifa tour

Upto 4 Stars

No Room(s) Selected

An Tour In Majestic Dubai

₹ 41,999/- ₹ 46,153/-.

  • Burj Khalifa
  • Palm Island

Dubai is one of the seven emirates that make up the United Arab Emirates. It is rather ....

Dubai

Hotels recommended by our Travel Experts

  • Top Rated Luxury Property

Expert Rating

Hilton Dubai Creek

5 km from City Center

Royal Ascot Hotel

4 km from City Center

Marriott Hotel Al Jaddaf, Dubai

Sparkling Dubai: Desert Safari & Burj Khalifa Tour Package

Sparkling Dubai: Desert Safari & Burj Khalifa Tour Package

₹ 38,999/- ₹ 42,078/-.

Cast away your never ending work with this customizable 6 nights 7 days

View Dubai Tour Packages from

Delightful Dubai Tour Package From Trivandrum

Explore The Hidden Nuances Of Dubai

₹ 54,999/- ₹ 59,139/-.

  • Dubai Museum
  • Jumeirah Beach
  • Aquaventure Waterpark

Delightful Dubai Tour With Vegetarian Food

Delightful Dubai Tour With Vegetarian Food

₹ 25,000/- ₹ 28,000/-.

  • Special Inclusions
  • Cultural Activities

Fly off with one of TravelTriangle’s best 4 nights, 5 days Dubai tour packages to....

Spectacular Dubai Sightseeing Tour Packages

Spectacular Dubai Sightseeing Tour Packages

₹ 46,000/- ₹ 50,549/-.

Create memories with your loved ones with our affordable 6 nights, 7 days Dubai....

An Tour In Glitzy Dubai

An Tour In Glitzy Dubai

₹ 37,000/- ₹ 40,659/-.

  • Airport Pickup/Drop

Dubai, an independent city-state and is the most modern and progressive emirate in the ....

Thrilling Dubai Tour: Dolphinarium & Burj Khalifa

Thrilling Dubai Tour: Dolphinarium & Burj Khalifa

₹ 45,500/- ₹ 48,467/-.

This sprightly Dubai 7 days package is what you need for a refreshing break. The fun-fi....

Energizing Dubai Tour Package On Independence Day

Energizing Dubai Tour Package On Independence Day

Looking for an exotic destination for your next vacation? The Independence Day weekend ....

Fascinating Dubai Independence Day Tour Package

Fascinating Dubai Independence Day Tour Package

₹ 24,500/- ₹ 25,010/-.

Take a thrilling summer break with this exclusively crafted 4 nights and 5 days bestsel....

Tour Package For Dazzling Dubai

Tour Package For Dazzling Dubai

₹ 30,000/- ₹ 32,967/-.

  • Leisure Time

Topping the wish list of every globetrotter, Dubai is characterised by artificial islan....

Dubai Local Tour Package

Dubai Local Tour Package

₹ 28,500/- ₹ 30,645/-.

  • Hill station

Dubai local tour package brings all the eye-catchy attractions and unu....

Fantastic Dubai City Tour Package

Fantastic Dubai City Tour Package

₹ 36,000/- ₹ 39,130/-.

Explore the beauty and high-technological world of Dubai with Dubai city tour p....

7 Days Tour Package To Dubai

7 Days Tour Package To Dubai

₹ 62,500/- ₹ 67,204/-.

  • Dhow Cruise

Get ready for the wonderful voyage to the world’s most amazing place with us. Boo....

5 Days Tour Package To Dubai

5 Days Tour Package To Dubai

₹ 68,000/- ₹ 73,118/-.

  • Desert Safari,

Planning a perfect getaway with family and friends to Dubai? Dubai tops the list of int....

5 Nights 6 Days Dubai Package From Kerala

5 Nights 6 Days Dubai Package From Kerala

₹ 85,000/- ₹ 98,837/-.

  • Scenic Views

Extraordinary Dubai Package From Ahmedabad

Explore Our Alluring 3 Nights 4 Days Dubai Tour From Ahmedabad

₹ 42,999/- ₹ 47,252/-.

Incredible Dubai Tour Package From Hyderabad

5 nights 6 days Dubai tour package from Hyderabad

₹ 73,999/- ₹ 81,318/-.

Upto 5 Stars

4 Nights 5 Days Dubai Tour Package From Mumbai

4 Nights 5 Days Dubai Tour Package From Mumbai

₹ 75,000/- ₹ 81,522/-.

4 Nights 5 Days Dubai Tour Package From Chennai

4 Nights 5 Days Dubai Tour Package From Chennai

₹ 77,000/- ₹ 83,696/-.

5 Nights 6 Days Dubai Tour Package From Goa

Feel The Opulence Of Dubai Like Never Before!

₹ 88,000/- ₹ 103,529/-.

5 Nights 6 Days Tour Packages From Kochi To Dubai

5 Nights 6 Days Tour Packages From Kochi To Dubai

₹ 85,000/- ₹ 100,000/-.

5 Days Dubai Package From Pune

5 Days Dubai Package From Pune

₹ 86,000/- ₹ 93,478/-.

4 Nights 5 Days Dubai Tour Package From Kolkata

4 Nights 5 Days Dubai Tour Package From Kolkata

₹ 78,000/- ₹ 89,450/-, dubai tour packages by theme, hotels in dubai by star ratings, hotels in dubai by themes, property types in dubai, faqs for dubai, how much does a dubai trip cost.

The cost of a Dubai trip would depend upon how many days you are planning to spend there, what sort of hotel you pick, as well as what sort of experiences you are looking for. For a budget traveler, the cost for a 4 days 3 nights trip can be less that INR 14,000, whereas for an ultra-luxe experience, a week in Dubai can cost INR 3,50,000.

What are the best bus tours in Dubai?

The Dubai bus tour allows you to witness the true charm of the place. While enjoying a bus tour, you can spot glistening sandy beaches, Dubai's iconic skyline, and world's tallest building. During the tour, you can stop by forts, palaces, historical souks, forts and palaces, restaurants, and other attractions that intrigue you. You can either pick a half-day tour or a full-day hop-on and hop-off tour while creating a personalized sightseeing itinerary.

What are the best places to visit on a Dubai trip?

Dubai is a dream destination for one reason, which is that it offers something or the other for travelers from all walks of life. Some of the best places to visit in Dubai include:

  • Shopping: Dubai Mall, Dubai Waterfront, Mall of the Emirates, Bur Dubai Souks
  • Culture: Grand Mosque, Madinat Jumeirah Mosque
  • Nature/Wildlife: Dolphinarium, Dubai Aquarium & Underwater Zoo, Dubai Creek
  • Man Made wonders: Burj Khalifa, Ski Dubai, Wild Wadi Waterpark, Miracle Garden

How much does it cost to visit Dubai for 7 days?

Based on the choices of your hotel and the experiences that you wish to have, the cost for a 7 days 6 nights Dubai tour could range from as low as INR 18,000 to as high as INR 1,00,000.

What are the best Dubai tour packages offered by TravelTriangle?

Below listed are some of the best Dubai tour packages offered by us:

Dubai & Abu Dhabi Holiday: Ferrari World, Burj Khalifa

Family Special Dubai Tour With Desert Safari

What's the best time to visit Dubai?

The best time to visit Dubai is between November and April, when the weather is pleasant and a traveler can enjoy a great number of attractions hassle free. However, Dubai is frequented throughout the year by tourists. Travelers visit the Emirati city for its various festivals like the Dubai Shopping Festival, Oktoberfest and more. Another peak season when families to travel to Dubai is between May & June, during the summer vacations.

Can these Dubai tour packages be customized?

TravelTriangle specialises in customizing tour packages to Dubai. Travelers can request the expert tour operators to personalise their Dubai tour itinerary according to their needs and specifications. The traveler is requested to elaborately discuss the changes required in the holiday itinerary for Dubai and other tour preferences with the tour agent in advance so that a smooth, comfortable holiday can be ensured for the traveler. 

What kind of clothing should a traveler carry on a Dubai tour?

Travelers should carry light cotton clothes on their Dubai tour. Also, while on a Dubai holiday, a tourist must ensure that their shoulders and knees are properly covered and should be respectful.

What is the ideal duration for a Dubai trip?

The ideal duration for a Dubai trip can be said to be around 5 to 6 days, within which you can cover most of the attractions that Dubai has to offer, along with a few on the outskirts of it. A Dubai trip for these many days will also ensure that you get to spend some time exploring the emirate on your own, be it shopping leisurely at the street markets or simply tucking into the local cuisine.

Keep 3 days for sightseeing, which would include all the monuments, malls and other places of interest. Keep another day for leisurely walks in the neighborhood, coupled with another couple of days of going on a desert safari, a cruise and of course, shopping. If you find yourself at a loss for things to do in Dubai, there is always the option of visiting one of the other emirates such as Abu Dhabi, which also has several attractions in store for visitors.

Which currency is accepted in Dubai?

AED (Arab Emirate Dirham) or Dh is the widely used currency in Dubai. Though, there are numerous ATMs available throughout the city, it is advised to keep some exchanged money handy.

What are the popular activities to do in Dubai?

Dubai offers a huge number of activities for all kinds of travelers. Some of the best activities which are perfect for everyone are given as below :

  • Cruising on Dubai Marina and Dubai Creek
  • Desert Safari in the golden sands of Dubai
  • Dune Bashing in a luxurious SUV
  • Quad Biking along the rugged terrain of Dubai
  • Helicopter ride for a bird’s eye view of Dubai. Seaplane Flight from Dubai Creek or Jebel Ali
  • Parasailing.

Can I get a visa on arrival in Dubai?

Visa on arrival in Dubai is provided to citizens of selected countries in the world. Some of these countries where citizens do not need a pre-arranged visas to come to Dubai are the GCC countries. Tourists coming from countries such as Australia, Austria, Andorra, Belgium, Brunei, Bulgaria, Canada, Cyprus, Croatia, the Czech Republic, Denmark, Estonia, France, Finland, Germany, Greece, Hong Kong, Hungary, Iceland, Ireland, Italy, Japan, Latvia, Liechtenstein, Lithuania, Luxembourg, Malaysia, Malta, Monaco, Netherlands, New Zealand, Norway, Poland, Portugal, Republic of Korea, Romania, San Marino, Singapore, Slovakia, Slovenia, Spain, Switzerland, Sweden, United States of America, the United Kingdom and the Vatican do not need a pre-arranged VISA on arrival.

What travel documents are required to carry along for a Dubai tour?

Travelers are supposed to carry a passport with a validity of 6 months, a visa with a validity of 30 days, and travel insurance for medical emergencies.

How safe is Dubai for tourists?

With its relatively low crime rate, Dubai can be considered quite a safe destination for tourists. However, taking safety precautions is always advised.

Why Book With Our Agents?

Only The Best Agents

Travelers deal with only the top 10% reviewed agents who are selected after a 23 step rigorous assessment procedure by TravelTriangle.

Ensuring Quality

TravelTriangle ensures quality service via verified partners by releasing the payment only after the booking vouchers/receipts are received by the traveler.

24*7 On-trip assistance by Local Travel Agents

Read on to find out why our customers love us!

Umesh's 7 days trip to Dubai

Paras's 7 days trip to dubai.

Paras Mehta

Rajkumar's 6 days trip to Dubai

Rajkumar Muthukrishnan

Sajith's 6 days trip to Dubai

Sajith Satheesan

Ar's 6 days trip to Dubai

Ar Gaurav Singh

Shivani's 3 days trip to Dubai

Shivani Chhetri

Naisargi's 8 days trip to Dubai

Naisargi Parikh

Ishika's 6 days trip to Dubai

Ishika Ahlawat

Bharat's 7 days trip to Dubai

Bharat Mittal

Sachin's 7 days trip to Dubai

Sachin Bangar

Maharashtra

Similar Destinations

Unlimited Choices. Customised Vacations. Happy Memories

620000+ Travelers served by 20+ experts

Starting from:

351000+ Travelers served by 20+ experts

262000+ Travelers served by 20+ experts

93000+ Travelers served by 20+ experts

611000+ Travelers served by 20+ experts

Places To Visit In Dubai

Let the experts guide you to the best of this mesmerizing destination

Palm Island in Dubai

Known as the world's largest artificially created island, The Palm consists of three archipelagos namely Palm Jumeirah, Deira Island and Palm Jebel Ali. Designed in the form of a palm tree, the construction of the mega-island had begun in early 2001. However, by the end of 2014, only the smallest archipelago known as the Pa...

Palm Jumeirah in Dubai

Majestically presiding over the Jumeirah coast, the Palm Jumeirah Dubai flaunts itself as the smallest among the three popular artificial archipelagos of the Palm Island. Created by Nakheel, a company undertaken by the Dubai government, the Palm Islands were meant to get extended up to the Persian Gulf, which would thereby ...

Sheikh Saeed Al Maktoum House in Dubai

The popular residential quarter of the former ruler of Dubai, Sheikh Saeed Al Maktoum House in Dubai , is presently addressed as an eminent tourist attraction. Owing to the rich decor and its historical significance, the place is visited by innumerable tourists every day. The house has been named after the most popular ruler...

  • Historical Sites

KidZania in Dubai

KidZania Dubai is a Mexican theme park based concept first established in Mexico in the year 1999. KidZania in Dubai is an award-winning 'edutainment' concept, which is specially designed for kids. Located on the second floor of the Dubai Mall, the KidZania city is a first of its kind in the Emirates via an exclusive partne...

  • Adventure Activities
  • Entertainment
  • Kid's Special

VR Park in Dubai

A first of its kind in the Middle East, VR Park in Dubai is the largest virtual reality park in the world spread over 7,000sqm across two levels. Get ready to experience a futuristic world where people will commute in drone taxis. The augmented reality park offers amusing and education experiences for kids and adults alike.

  • Ideal for friends

Things To Do In Dubai

Your list of the best things to do, compiled on the basis of actual traveler experiences

Ibn Battuta Mall in Dubai

Clearly, one of the most exotic and different shopping adventures of Dubai, Ibn Battuta Mall is a must visit for every shopaholic. A confluence of cultures, architecture, and luxury; the Ibn Battuta Mall is spending an entire day in the midst of some adventurous shopping and entertainment.

The Inspiration Behind the Mall

  • Ideal For Family

Spa in Palm Jumeirah

Dubai is a land of luxuries, and the spa in Palm Jumeirah is one of the many that travelers love to indulge in. The Spa in Palm Jumeirah is a complete package of relaxation and rejuvenation that captivates the mind, body, and soul of the tourists visiting Dubai. Palm Jumeirah is one of the most high-end locations in Dubai a...

  • Ideal for couples
  • Activities for couples

Spice Souk in Dubai

While Dubai might be celebrated for its sumptuous shopping centers, inventive engineering and energetic gatherings, any tour to these spots are inadequate without visiting the souks. The spice souk in Dubai lets you breathe life into your life no totally different levels of flavors. The customary markets or souks of Dubai a...

  • Spice Bazaar

Fun at Global Village in Dubai

Global Village Dubai brings to you the combined cultures of 90 different world all inside one ground. Located at Sheikh Mohammed Bin Zayed Road, Global Village Dubai is the largest shopping, tourism, entertainment, and leisure project in the entire world. This is also the country's first-ever destination that brings about e...

The Walk at JBR in Dubai

The Walk at JBR In Dubai is a 1.7 km stretch at the ground level of Jumeirah Beach Residence complex in Dubai . Spread across an area of 800,000 sq ft, JBR Dubai is divided into two prime levels that encompass over six different sections. Set around 6 blocks of the skyscrapers, JBR Walk is the run for one mile parallel to th...

Dubai Travel Guide by Category

Travel stories logo

Travel Stories

Accommodation logo

Accommodation

Things to do logo

Things to Do

Food logo

Food & Cuisine

Safety & Pro tips logo

Safety & Pro Tips

Dubai Travel Stories

Famous for a number of tourist attractions, couples can enjoy cultural experiences, explore the sandy beaches, the man-made towers, enjoy the thrilling activities which can be best availed with a well-designed budget Dubai holiday package from India . For some adventure, couples can personalize the Dubai tour packages all inclusive and go for desert safari, trekking, scuba diving, dune bashing, off-roading, skiing, and a lot more.

Have a glance through a few travelogues mentioned below, and see what our customers have to say about their experiences on a Dubai vacation.

Travelogue Title When age is just a number, TravelTriangle breaks down all barriers!

thumbnail

Duration: 4N/5D

Accommodation: Hotel

Experiences cherished: Dhow Cruise, Dubai Museum, Palm Jumeirah, Dubai Mall

Come back for: Desert Safari, Sunset views

I was a little apprehensive to embark on a solo trip to an international destination. And then my daughter insisted to take the plunge and booked a package with TravelTriangle. Areeb- one of their travel representatives helped me book a deal basis my requirements, and assured that all the hassles would be taken care of by the travel organization. As I arrived at Dubai Airport, a driver was already waiting outside the airport to escort me to the hotel. During my vacation of 4 days, I got a chance to enjoy the Dhow Cruise; explore the jaw-dropping skyscrapers and other attractions, such as Dubai Museum, Palm Jumeirah, and Burj Khalifa; and indulge in dune bashing, which was quite adventurous! And, I must say if at the age of 67 it became possible for me to venture out on a solo trip, then the credit goes to TravelTriangle. For, it was always there to provide me with all the assistance.

Travelogue Reliving childhood on a Middle East tour through a well-curated trip by TravelTriangle!

thumbnail

Duration: 5N/6D

Experiences cherished: Ferrari World, Dhow Cruise, Burj Khalifa

Come back for: Underwater Zoo, Ski Dubai, Desert Safari

I have always been fascinated by the Middle East, and wanted to explore the deserts of Arabia. However, this time budget was a constraint and I was seeking an affordable Dubai travel package , which brought me to TravelTriangle. I zeroed in on a deal with one of their agents, and was delighted with every experience that this package comprised of. My wife and I sailed through the splendid landscapes on the Dhow Cruise. Our tour to Abu Dhabi let us relive our childhood while we experienced thrill rides at Ferrari World. And, the spellbinding architecture of Sheikh Zayed Mosque left us jaw-dropped. As we entered Dubai Museum, there was so much to learn about the history of Dubai, while the Burj Khalifa let us experience a spellbinding bird’s eye-view. We were skeptical about the back-breaking experiences on Desert Safari, but TravelTriangle made our experiences thrilling and fun-filled at the same time. And, it made us confident enough to indulge in rides at Ski Dubai. Our tour to Underwater Zoo, Dubai Aquarium, Aquaventure Waterpark, and a shopping spree at Meena Bazaar and Gold Souk were icing on the cake. To sum up, we were seeking a wonderful experience, and people at TravelTriangle made it an extraordinary one for us.

Travelogue TravelTriangle caters to every budget! Couldn’t believe it? Have a look!

thumbnail

Experiences cherished: Dubai City tour, Burj Khalifa, Arabic fish, Grand Mosque

Come back for: Dhow Cruise, Desert Safari, Ferrari World

I was seeking a vacation that offers sightseeing, leisure and luxury, and yet doesn’t burn a whole into my pocket. And, to my surprise, TravelTriangle gave us a 5 days Dubai holiday package that consisted of everything. Our itinerary included city tour of Dubai and Abu Dhabi covering all the major attractions along with the adventurous activities at Desert Safari, and an evening cruise on Dubai Creek, yes! We still couldn’t make our calculations how TravelTriangle managed to provide us with such luxurious offerings at a cost less than INR 60000.

Housing Burj Khalifa, Desert Safari, Palm Jumeirah, Dubai Aquarium and Underwater Zoo, which are thronged by tourists throughout the year; Dubai is crammed with a bevvy of such magnificent landmarks that offer a glimpse into the culture of the city. If exploring new places, and savoring a new culture excite you, then go ahead, and book our Dubai packages from Delhi, Mumbai, Bangalore, and Kolkata consisting of these famous places. And, provide us with an opportunity to offer you an unmatchable experience. Let’s take a look at a few of our recommendations that you cannot afford to miss out on.

What Are The Best Places To Stay In a Dubai trip?

With such an incredible list of attractions to explore, Dubai is a travel destination that never ceases to entice you. However, before you freeze your dates to fly to the capital of the Emirate of Dubai, make sure a perfect accommodation is already booked, or you are equipped with a list of the best places well in advance. Or, simply avail our Dubai tourism packages from Delhi, Mumbai, Bangalore, Hyderabad, Chennai, Amritsar & other major Indian cities, and let us manage all the hassle for you.

Here are a few of our recommendations for a stay in Dubai that you might consider.

Accommodation Armani Hotel Dubai

Star Category - 5-star

Starting Price (Per Night) - INR 21,000 onwards

Location - Burj Khalifa - Sheikh Mohammed bin Rashid Blvd - Downtown Dubai - Dubai - United Arab Emirates

Nestled at the world-famous structure called Burj Khalifa, Armani Hotel Dubai always tops the list of people seeking luxury and sightseeing. Offering great views of Burj Plaza, Dubai Mall, and Dubai Fountain, this five-star hotel is also equipped with world-class facilities, including a spa, contemporary couture, and private cushioned sun loungers that can be availed with an upgrade to a balcony stay.

Accommodation The Palace Downtown Dubai

Starting Price (Per Night) - INR 13000 onwards

Location - Sheikh Mohammed bin Rashid Blvd - Dubai - United Arab Emirates

Head towards the southern side of Dubai Creek, and here is a perfect combination of traditional and modern lifestyles awaiting you! Book a stay in the Palace Downtown Dubai, and enjoy the view of the world’s tallest building- Burj Khalifa from your room. Comprising a dining option, a spa, lavish rooms with scenic views, and a palm-fringed swimming pool, this hotel is equipped with every world-class facility you must be looking for.

Accommodation At The Top Hostel

Star Category - NA

Starting Price (Per Night) - INR 3100 onwards

Location - Elite Residence, opposite Barasti Bar, next to Marina Crown, Dubai 62635 United Arab Emirates

Located to the south of Jumeirah Beach in the district of Dubai Marina, At The Top Hostel is the best option if you want to experience throbbing nightlife. Book a stay here amidst the man-made marina through our Dubai vacation packages , and have an amazing experience. Featuring comfy rooms, a small kitchenette for visitors, and clean linens, and having the advantage of being located in the proximity to nightclubs, bars, cafes, and beaches, there is never a dull moment.

Accommodation Jumeirah Zabeel Saray

Starting Price (Per Night) - INR 16000 onwards

Location - Crescent Rd - Dubai - United Arab Emirates

Blessed with historic decor and Turkish murals, the hotel of Jumeirah Zabeel Saray can be called a true masterpiece of art and architecture. Moreover, with its bewitching features, including a private beach, infinity pool, and award-winning Talise Ottoman Spa, here is your chance to unwind in unbridled luxury. Book a stay in one of its sumptuous suites overlooking the Arabian Gulf, and have an ultimate experience.

Owing to its countless attractions and exhilarating experiences to cherish, there is no dearth of world-class accommodations to choose from. To avail a perfect stay that fits your bill, all you need to do is book one of our Dubai trip packages , and voila! You are all set to embark on an excursion to the majestic city of Sheikhs without any hassle.

Accommodation Key One Homes Ocean Heights Tower

Star Category - 4-Star

Starting Price (Per Night) - INR 5000 onwards

Location - Office 601B, Al Zarouni Business Centre - Sheikh Zayed Rd - Dubai - United Arab Emirates

Ocean Heights in Dubai is a classy property best suited for couples, families and all kinds of travelers. The property maintains an outdoor pool offering a relaxing session, gym for fitness freaks, well-equipped kitchen and cosy and stylish bedrooms with spacious balconies. Other than this, travelers can also indulge in a relaxing spa session at Ocean Heights.

Things to do in Dubai

Apart from awe-inspiring tourist hotspots, our Dubai tour packages from India are also coupled with thrilling sports and other activities. Skydiving, sandboarding, dune bashing, skiing, snowboarding, bungee jumping, shark diving, flyboarding, micro lighting, deep-sea fishing, and scuba diving are some of the best things to do can be enjoyed with tour packages designed for this exotic travel destination.

Things To Do Desert Safari

Famed for the thrilling desert safari, Dubai lets you navigate through the golden sands, and cherish an adrenaline rush like ever before. Brace yourself for this adventurous excursion, and get a chance to witness the beautiful sight of a sunset, leaving you in awe. Besides that, a camel ride and sandboarding along with an assorted BBQ dinner make the whole experience quite a treat.

Things To Do Dubai Aquarium

Housing more than 140 species, including Sand Tiger sharks, here is your chance to experience the world of marine animals. Snuggled in the Dubai Mall, a visit to Dubai Aquarium is a must one for animal lovers and every tourist like you who wants to experience something new.

Things To Do Scuba Diving

Do you want to take a dive and explore the underwater world? Then, there are plenty of diving schools to help you take a deeper dive. Head to the Gulf, which is the only location providing diving services, and grab an opportunity to go close to thousands of marine animals while partaking in scuba diving.

Things To Do Air Balloon Ride

Another thrilling adventure to try in Dubai is the hot air balloon ride away from the hustle-bustle and monotony of city life. Enjoy the spectacular views of the desert from the top, and have the experience to be remembered for a lifetime.

Things To Do Shopping

Famed for its shopping mall, called the Dubai Mall, the city offers you an exemplary shopping experience. Housing the world-famous Gold Souk and other shopping spots, this destination urges you to spend extravagantly even if you deny being referred to as a shopaholic. The Dubai trip cost given in the packages does not include the expenses of shopping, so shopping expenses need to be borne by the travelers themselves.

Things To Do Witness Dubai Fountain Show

Out of all the things that one can witness in Dubai, one of the most intriguing is to witness the fountain show in the Dubai Fountain. Dubai holiday packages let you explore various parts of Dubai including the Dubai Fountain. The streams of the fountains go up to 150 meters. The colourful water fountain synchronizing to various songs is truly a delight to witness. This show is a perfect plan to add to your evening in Dubai. There are many fountain shows that take place every evening (except on Fridays).

Things To Do Visit Theme Parks

Dubai is a place to find some of the best modern marvels and some truly iconic theme parks. Some of the worth visiting theme parks in Dubai are Legoland Dubai, Ferrari World, IMG Worlds of Adventure, MOTIONGATE, and Bollywood Parks Dubai. As per one’s preferences and liking one can opt to visit any of these theme parks. Each of them has their own theme world waiting for you to step into. IMG Worlds of Adventure is considered one of the most amazing indoor amusement parks that cover various adventure zones such as Lost Valley, Cartoon Network, Marvel, IMG Boulevard, and NOVO Cinemas. Some of the highlights of these theme parks are The Haunted Hotel, Thor Thunder Spin, Bollywood Boulevard Stage, Cross Road Stages, Stars On Steps Stage, Dino Carousel, Adventure Fortress, Lazy Town TreeHouse, Mumbai Express Stage, Rangmanch Stage, Rajmahal Theatre, Turbo Track, Flying Aces, Turbo Tower, Speedway Race, etc. Whether you are on a trip with family members or on a honeymoon, it is always a fun time visiting these theme parks.

Things To Do Museum & Library Tour

Dubai is home to numerous museums and libraries that let you explore the various evolutionary eras that lead to present Dubai. There is so much enstore for a history lover in Dubai. There are many Dubai packages that take you to various museums and libraries. Moreover, one can also explore them during the leisure time. Some of the most visited museums of Dubai are Saruq Al Hadid museum, Etihad Museum, Dubai Museum, Al Shindagha Museum, Museum of the Future, Naif Museum, Al Shindagha Museum, and Dubai Police Museum. Some of the libraries that one can visit are Al Ras Public Library, Al Rashidiya Public Library, Deira’s Neighbourhood Library, etc.

Things To Do Dinner in The Sky

A Dubai trip package offers you its share of luxury experiences such as dining at Dinner in The Sky. This fine dining restaurant is unlike any other restaurant in the world. It offers you a lip-smacking meal on a dining table that is suspended in the air at a height of about 165 feet. Thus, also offering you the picturesque view of the magnificent skyline of Dubai. So if you are in for an unusual experience, then this dining experience is apt to indulge in. Moreover, it is also a great option for a fun evening plan.

Things To Do Savor the Street Food

Dubai street food is where you find an amalgam of many cuisines such Emirati cuisine, Indian cuisine, Omani cuisine, etc. Therefore, street food treats you with multicultural cuisine. Some of the famous dishes to relish in the streets of Dubai are shawarmas, shish tawouk sandwich, Oman chips roll, samosa, mankish, fareed, harees, knafeh, etc. Some of the places that you can visit in order to savor these dishes are Downtown Dubai, Bur Dubai, Global Village, and Satwa.

And, the list of its enticing offerings doesn’t end here. As you book our Dubai tour packages from India including flights , access to our comprehensive guide may help you delve deeper into every other experience that makes this city quite a unique travel destination.

Which Are The Top Places To Satiate Hunger On A Dubai holiday?

When you are in Dubai, you just can’t escape a tour to its cafes and restaurants that offer you an amazing opportunity to traverse you through the world of aromas and flavors. With their chilled-out ambiance and sumptuous menu, they are the perfect escapes to the scorching heat and pulsating energy of the bustling city. Famed for its authentic dishes, such as Al Harees, Shwarma, and Hummus, here is a scrumptious treat awaiting you at every corner!

Take a look at our list of recommendations that you can head to while enjoying your vacation through our Dubai trip packages .

Restaurants & Food Hard Rock Cafe

Featuring live music, vogue fashion items, and rock memorabilia, the iconic establishment of Hard Rock Cafe is a place to pamper your senses. Come here to party the night away, and gorge on flavorful cuisines that may tickle your memories for life.

Restaurants & Food Arabian Tea House

Want to experience the traditional Emirati lifestyle? Head to Arabian Tea House, and it would not cease to amaze you. Featuring rich culture and hospitality, the highlight of this cafe is its architecture and a delightful menu serving some of the best traditional meals. A perfect option to indulge in an oasis of tranquillity, this cafe is a treat in every sense.

Restaurants & Food Piccolo Mondo Bay

Nestled in Dubai Marina, Piccolo Mondo Bay is a one-of-a-kind restaurant in the city of Dubai. Famed for its chilled out music, lavish interior, and surroundings replete with scenic backdrops, this place is meant to beguile you to extend your sojourn again and again.

Crammed with plenty of other restaurants and cafes, Dubai is meant to leave your taste buds with a wonderful experience. And thus, if you are a foodie, we insist you to choose one of our Dubai packages, get it customized through our travel agents, and set off for a sumptuous journey in the midst of an oasis of luxury in no time.

Safety Measure For A Trip To Dubai

Carry basic requirements that ensure safer and smooth travel. This includes masks, hand sanitisers, disinfectant, etc.

Maintain social distancing in public places

Note that the legal drinking age in Dubai is 21 years. Moreover, one can enjoy a drink in hotels or other licensed venues. Drinking in public places and causing a nuisance is strictly prohibited and will most definitely cause trouble.

Dubai has a zero-tolerance policy when it comes to drugs so steer clear of drugs.

Make sure you have all the important documents such as passport, visa documents, travel insurance documents, and return tickets.

Avoid public display of affection.

Make sure to dress in an appropriate manner and not provocatively with minimum skin show.

If you are a photographer, always ask for permission before taking pictures of others.

If you are visiting during the months of Ramadan, make sure to be extremely careful to not offend the religious beliefs of locals.

Travel Tips For A Trip To The Dubai

Albeit, the exquisite attractions of Dubai are well-documented, it is vital to get yourself acquainted with the culture and other essential information to make the most of your Dubai vacation packages .

Though, UAE is considered one of the safest destinations for solo and women travelers, still, it is highly advised to avoid wearing revealing clothes away from beaches.

The transportation system and numerous hotels of Dubai are well-equipped to accommodate wheelchairs. Hence, disabled people can also enjoy a tour of Dubai without any hassle.

Unlike other travel destinations, Dubai holidays do not require any special immunization. However, it is always recommended to get yourself checked before traveling to a new place.

Make sure to carry sunscreen, sunglasses, and lip balm. Brim hats can also be an important addition to avoid direct sunlight.

Carry a UAE's power adapter if the voltage differs in your country.

Beach bags will save you the trouble of carrying things separately.

Pack swimwear and sarongs, a personal first-aid kit and keep yourself equipped with a waterproof phone case.

Carry a mosquito and insect repellent cream, power banks, camera and ear pods.

Try to avoid making a visit to Dubai during Ramadan, as locals observe fast during this time of the year, and you will not find any restaurant or cafe open.

Try to book your accommodation through our Dubai travel packages well in advance to get a perfect stay at affordable rates.

Choose to brush up on some Arabic phrases before making a tour to Dubai, and get acquainted with locals there.

Try to explore the place while booking local taxis for convenience, comfort, and an affordable journey.

Bear in mind that people are not allowed to carry alcohol in public places, including beaches until they are private ones.

Dubai is a futuristic city with glitzy skyscrapers, historical sights, and nightlife to cherish at least once in your life. This vibrant city snuggled in the middle of the Arabian Desert attracts millions of tourists every year to indulge in their favourite pastimes. And, if you are also one of them seeking a vacation where you can explore magnificent attractions, savour lip-smacking cuisines, partake in adventure, and indulge in luxury all at the same time, then Browse through our Dubai tour packages including flights , and select a tour itinerary which suits best to your budget and interests. And, grab a chance to enjoy sightseeing, adventure, and shopping on a wonderful exotic holiday in an oasis of luxury that Dubai is.

Your Preferences

Where do you want to go?

Category Pages

  • India Packages
  • International Packages

Domestic Tour Packages

  • Kerala Packages
  • Himachal Packages
  • Uttarakhand Packages
  • Goa Packages
  • Andaman Packages
  • Sikkim Packages

International Tour Packages

  • Europe Packages
  • Thailand Packages
  • Maldives Packages
  • USA Packages
  • Bali Packages
  • Dubai Packages
  • Hong Kong Honeymoon
  • Macau Honeymoon
  • Hong Kong Packages
  • Macau Packages
  • We are hiring!
  • Testimonial
  • Travelogues
  • Terms and Conditions
  • Privacy Policy

Corporate Office:

Holiday Triangle Travel Private Limited

Address: Plot No - 52 , 3rd Floor,

Batra House , Sector 32,

Gurugram - 122001 ,Haryana

Landline: 1800 123 5555

Connect with us on :

Payment Options

All rights reserved © 2024

Members save 10% or more on over 100,000 hotels worldwide when you’re signed in

best dubai travel packages

Dubai Vacation Packages

Book a hotel + flight or car together to unlock savings.

  • Things to do

I only need accommodations for part of my trip

  • payments icon Better together Save up to CA $775 when you book a flight and hotel together*
  • lob hotels icon Find the right fit With over 300,000 hotels worldwide, it's easy to create a perfect package
  • lob packages icon Rest easy Plan, book, and manage your trip all in one place

Top vacation destinations in Dubai

Jumeira Beach and Park which includes a sandy beach as well as a family

Top Dubai Vacation Deals

Address Beach Resort

Address Beach Resort

Reviewed on Mar. 20, 2024

Palace Downtown

Palace Downtown

Reviewed on Apr. 2, 2024

Habtoor Grand Resort, Autograph Collection

Habtoor Grand Resort, Autograph Collection

Reviewed on Mar. 21, 2024

Address Sky View

Address Sky View

Reviewed on Apr. 7, 2024

 FIVE LUXE

Reviewed on Apr. 9, 2024

Where to stay in Dubai

Aquaventure showing a waterpark and rides

Palm Jumeirah

Discover an archipelago of artificial islands featuring recently opened destinations like The Pointe, Club Vista Mare, and Nakheel Mall. Enjoy various hotels, resorts, and hotel residences, while exploring retail and dining options, all connected by the Palm Jumeirah Monorail.

Dubai Mall which includes interior views and shopping

Downtown Dubai

Home to iconic landmarks like Burj Khalifa and The Dubai Mall, this mixed-use complex offers luxury shopping, an Olympic-size ice rink, and a variety of dining options along Sheikh Mohammad bin Rashid Boulevard.

Dubai Marina showing a marina, a city and skyline

Dubai Marina

Artificial canal city boasting the world's largest human-made marina, featuring Dubai Marina Mall with 140 retail outlets, and The Walk at JBR for dining. Enjoy Marina Promenade views and access Al Sufouh Tramway for easy transport.

Default Image

Jumeirah Beach Residence

Waterfront community in Dubai Marina, Jumeirah Beach Residence boasts 40 towers, The Beach retail complex, and a 1.7-km strip called The Walk. Enjoy views of Ain Dubai on Bluewaters Island and easy access to Dubai Marina, Dubai Tram, and Dubai Metro.

Gold Souk which includes a city, city views and signage

Historically significant, this district boasts centuries-old gold and spice souqs, ancient forts, and iconic structures. Shop at City Centre Deira mall, explore the Waterfront Market, or take a boat across Dubai Creek.

Dubai Hotel Deals

Atlantis, The Palm

Reviewed on Apr. 5, 2024

Le Meridien Dubai Hotel & Conference Centre

Reviewed on Apr. 8, 2024

JW Marriott Marquis Hotel Dubai

Reviewed on Mar. 31, 2024

Explore other types of vacation packages

best dubai travel packages

All Inclusive Vacations

best dubai travel packages

Beach Vacations

best dubai travel packages

Family Vacations

best dubai travel packages

Golf Vacations

best dubai travel packages

Luxury Vacations

best dubai travel packages

Romantic Vacations

best dubai travel packages

Ski Vacations

Frequently asked questions, discover the most popular places to visit in dubai, burj khalifa.

The tallest man-made structure on earth is a city in the sky that houses luxury apartments, offices and a hotel.

Browse, shop, play and dine at one of the largest shopping and entertainment malls in the world.

Marina Beach

Nothing says vacation like spending a lazy day at Marina Beach, a popular beach in Dubai. Stroll along the marina or attend a sporting event in this family-friendly area.

What to do in Dubai

Dubai: desert safari with bbq dinner & quad biking options, dubai marina: yacht tour with breakfast or bbq (lunch or dinner), dubai: desert safari with vip bbq and optional quad bike, other vacations you might like.

  • Vacations and getaways similar to Dubai
  • Expedia's Latest Trends
  • Abu Dhabi Vacations
  • Fujairah Vacations

Dubai Tour Packages

Compare dubai tours & packages from top travel agents.

best dubai travel packages

Oct 01, 2023: Global Village Dubai is open from 18 October 2023 to 28 April 2024 and Miracle Garden Dubai is open from 29th September 2023 to 30th April 2024.

Ideal Duration of Dubai Tour

Best time to visit dubai, dubai visa for indians, why should you buy a package for dubai, honeymoon in dubai.

A honeymoon in Dubai is the perfect romantic trip you could ever ask for. An urban jungle fused with traditional Arabic culture and cuisine, Dubai offers experiences ranging from thrilling adventures in the desert to the towering Burj Khalifa, luxury shopping and dining experiences in some of the best restaurants and souks. It also boasts some of the most luxurious hotels and resorts. Holidify’s Dubai honeymoon packages are customisable to suit every couple’s needs, whether there be a need for adventure, leisure or a bit of both.

Family Trip to Dubai

Dubai makes for one of the best cities for a family holiday with lots of attractions and activities for kids and adults alike. With Holidify’s Family Tours in Dubai, enjoy the Aquaventure waterpark, Lost chambers aquarium and the Dubai Aquarium and underwater zoo. The desert safari tour also can be enjoyed with camel rides, dune buggy rides and cultural performances over a delightful barbeque dinner.

The various beaches are hubs for watersports such as parasailing, banana boat rides, speed boats and more to keep the young ones engaged.

Things to Do in Dubai

Desert Safari with BBQ Dinner:  Enjoy a thrilling safari across the mighty sand dunes with the sun glistening across the landscape. After sundown, enjoy a sumptuous traditional dinner coupled with a stunning dance performance. Dubai Shopping Festival:  The Dubai Shopping Festival is a haven for all shopaholics coming to Dubai from the end of December until late January-early February. Visitors can enjoy a host of events, live shows by famous artists, sports and other fun family activities and gorge upon delicious cuisines all laid bare for the curious. In addition, the outdoor Bazaar and fireworks display with the recent addition of the Drone Show are not to be missed.

Dhow Creek Cruise:  Cruise on a traditional wooden boat along the Dubai Marina, soaking in the urban architecture of the city, bathed in sunlight, night lights or even fireworks. A leisurely cruise suited for both couples and families, you can enjoy the cruise during the day, evening, or night and even pair it with a beautiful dinner. Skydiving:  For those who enjoy the thrills of life and chase adrenaline rushes, skydiving is one of the best experiences we recommend. Falling from a height in groups or solo makes for a thrill that few other experiences can replicate. With some of the best instructors, be assured that your skydiving experience is in safe hands and will be one you remember forever.

Aquaventure Waterpark:  Make a splash at Aquaventure Waterpark for a fun day enjoying various rides and games at the Atlantis Hotel. No family trip to Dubai is complete without visiting this popular water-themed park.

Places to Visit in Dubai

By purchasing a Dubai tour package, you can enjoy a seamless experience, cost savings, local expertise, exclusive experiences, reliable support, and cultural insights. These advantages enhance your overall trip, allowing you to make the most of your time in Dubai while overcoming the challenges that travelers may encounter.

Popular Dubai Packages

Price Range (per person)

Combined With

Starting From

Holidify connects you with top travel agents

Compare Custom Quotes and get the best package deal

1 .Trusted Network Of 3000+ Agents. 2 .Book everything together, including stay & transport. 3 .Compare agent profiles & verified reviews

How It Works?

Compare Custom Quotes from Top Travel Agents

1 .Tell us about your trip . 2 .Get Custom quotes from top agents. 3 .Choose the package you like

Choose any duration

Create your own customised package

Plan your trip to Dubai with the help of local experts

Choose hotel-type

Sightseeing & activities

All Transport Options

Meals & other inclusions

From Top Travel Agents

64 Dubai Tour Packages Found

Filter by duration

*Final price will be shared by our partner agents based on your requirements

best dubai travel packages

Best Dubai Tour Package - Visit to Burj Khalifa Included

4 Nights / 5 Days

₹ 38,000* per person

₹ 38,000*

per adult on twin sharing

Dubai Essence Retreat Package for 3 Nights With Desert Safari

3 Nights / 4 Days

₹ 30,000* per person

₹ 30,000*

Dubai Luxe Escape for 6 Nights With Limousine & Yatch Ride

6 Nights / 7 Days

Dubai(6N) → Abu Dhabi(0N)

₹ 62,000* per person

₹ 62,000*

Expert Choice

Majestic Dubai Package with Abu Dhabi Day Tour: Ferrari World Included

5 Nights / 6 Days

Dubai(5N) → Abu Dhabi(0N)

₹ 45,000* per person

₹ 45,000*

Not sure which package to pick for Dubai?

Talk to our trip experts now to get the best deal

Your Email ID

Mobile Number

Dubai 5 Nights Family Package with Yas Island Tour

Dubai(3N) → Abu Dhabi(2N)

₹ 51,000* per person

₹ 51,000*

Trending Now

Splendid Dubai 4 Nights Package with Miracle Garden & Global Village

₹ 35,500* per person

₹ 35,500*

Dubai Honeymoon Haven Package: With Private Desert Safari

₹ 39,000* per person

₹ 39,000*

10 Days Dubai & Turkey Discovery Tour Package

9 Nights / 10 Days

Dubai(4N) → Abu Dhabi(0N) → Istanbul(3N) → Cappadocia(2N)

₹ 103,000* per person

₹ 103,000*

Offbeat Explorer

Experience the Best of Dubai and Thailand

8 Nights / 9 Days

Dubai( 3N) → Phuket(3N) → Bangkok(2N)

₹ 76,000* per person

₹ 76,000*

Dubai Atlantis the Palm Experience with Aquaventure Waterpark (1 Night Stay Included)

₹ 108,493* per person

₹ 108,493*

Dubai Tour with 4 Nights Stay at Gevora Hotel (Tallest Hotel)

₹ 39,400* per person

₹ 39,400*

All Of Dubai Tour Package with 4 Nights Stay at Royal Ascot

₹ 33,500* per person

₹ 33,500*

11 Day Turkey and Dubai Itinerary with Hot Air Balloon Ride

11 Nights / 12 Days

Istanbul(4N) → Cappadocia(2N) → Pamukalle(2N) → Dubai(3N)

₹ 110,800* per person

₹ 110,800*

Holiday in Dubai and Thailand Tour Package

Dubai(3N) → Krabi(3N) → Pattaya(3N)

Dubai and Oman Tour Package

Dubai(3N) → Muscat(3N)

₹ 49,000* per person

₹ 49,000*

Dubai Family Escape for 5 Nights: Tickets to Dubai Aquarium & Underwater Zoo

₹ 49,999* per person

₹ 49,999*

Dubai 7 Days Package - Couples Special

₹ 72,000* per person

₹ 72,000*

Exquisite Dubai & Abu Dhabi Getaway: Museum of the Future Included

Dubai(3N) → Abu Dhabi(3N)

₹ 70,000* per person

₹ 70,000*

Budget-friendly Dubai Tour Package & Dubai Shopping Festival

₹ 34,500* per person

₹ 34,500*

Exclusive 5 nights Dubai Tour Package (Candle light Dinner in Sanjeev Kapoor Restaurant)

₹ 32,900* per person

₹ 32,900*

Singapore Dubai Tour Package

Singapore(3N) → Dubai(3N)

₹ 71,000* per person

₹ 71,000*

Dubai Explorer's Retreat for 3 Nights

₹ 36,500* per person

₹ 36,500*

Dubai Mauritius Honeymoon Retreat Package

Mauritius(4N) → Dubai(2N)

₹ 58,000* per person

₹ 58,000*

Quick Honeymoon Getaway in Dubai with Desert Safari & River Cruise

₹ 25,500* per person

₹ 25,500*

Dubai Grand Discovery Package with Ras al Khaimah & Abu Dhabi Tour

Dubai(5N) → Ras Al Khaimah(0N) → Abu Dhabi(0N)

₹ 65,000* per person

₹ 65,000*

Cheapest Tour Package of Dubai with Desert Safari

₹ 29,425* per person

₹ 29,425*

Dubai Trio Package (City Tour, Cruise, Desert Safari)

₹ 32,400* per person

₹ 32,400*

Dubai and Abu Dhabi Tour Package for 5 Nights

₹ 48,000* per person

₹ 48,000*

4 Nights Dubai Package With Stay at Golden Sands Hotel Apartments

₹ 68,000* per person

₹ 68,000*

India and Dubai Tour Package

Delhi(2N) → Agra(1N) → Jaipur(2N) → Dubai(3N)

₹ 41,000* per person

₹ 41,000*

Emirates with Oasis of Arabia - 9 Nights Dubai Tour Package

Dubai(2N) → Fujairah(1N) → Al Ain(1N) → Abu Dhabi(1N) → Al Dhannah(1N) → Al Hofuf(1N) → Riyadh(2N)

Arabian Odyssey Dubai & Abu Dhabi Package with Al Ain Day Tour

Dubai(2N) → Abu Dhabi(2N) → Al Ain(0N)

₹ 36,450* per person

₹ 36,450*

Friends Trip to Dubai for 4 Nights

₹ 31,990* per person

₹ 31,990*

Delightful Dubai and Ras Al Khaimah Tour Package

Dubai(3N) → Ras Al Khaimah(1N)

Wonderful Dubai Honeymoon Tour Package

₹ 50,000* per person

₹ 50,000*

Special Dubai Tour Package & Abu Dhabi Day Tour

Dubai(4N) → Abu Dhabi(0N)

Dubai Package for 4 Nights 5 Days - Dhow Cruise Dinner

₹ 32,000* per person

₹ 32,000*

Dubai 5 Nights 6 Days Package with Ferrari World

₹ 84,800* per person

₹ 84,800*

Budget Dubai Friends Tour Package

₹ 30,500* per person

₹ 30,500*

Luxurious Dubai Tour Package for 4 Nights - Stay at Hyatt Regency Dubai

₹ 85,000* per person

₹ 85,000*

Exquisite Arabian Adventure - Dubai, Abu Dhabi & Doha

Dubai(3N) → Doha(3N)

₹ 60,500* per person

₹ 60,500*

Fun Family Dubai 4 Nights Package - Hot Air Balloon Ride

₹ 82,999* per person

₹ 82,999*

Mesmerising Dubai Tour including 1N Stay at Gevora (Tallest Hotel)

₹ 38,500* per person

₹ 38,500*

Exquisite Arabian Adventure - 6 Nights/7 Days

Luxurious dubai and abu dhabi tour - stay at yas viceroy and jw marriott.

Abu Dhabi(2N) → Dubai(3N)

₹ 93,000* per person

₹ 93,000*

Ultimate UAE Tour Package - Yas Island Adventure

7 Nights / 8 Days

Dubai(3N) → Ras Al Khaimah(1N) → Al Ain(1N) → Abu Dhabi(2N)

10 Days Dubai and Thailand Tour Package

10 Nights / 11 Days

Dubai(4N) → Bangkok(3N) → Phuket(3N)

Dubai Shopping Tour for 4 Nights - Luxury Yacht Dinner Cruise

₹ 42,500* per person

₹ 42,500*

Luxurious Dubai Package - Stay at JW Marriott

Best of uae tour package - 6 nights 7 days.

Dubai(4N) → Al Ain(1N) → Abu Dhabi(1N)

Latest Reviews for Dubai

Dr. Kailey's Trip to Dubai

(Written on 05 Feb, 2024)

Trip to Dubai

Sunil's Trip to Dubai

(Written on 31 Jan, 2024)

fantastic trip and well organised planing

YASHPAL's Trip to Dubai

(Written on 27 Jan, 2024)

Sohail's Trip to Dubai

(Written on 30 Dec, 2023)

Dubai vacation

Gada Dhar's Trip to Abu Dhabi, Dubai

(Written on 03 Nov, 2023)

Pradeep JALINDAR's Trip to Dubai

(Written on 13 Oct, 2023)

Dubai Packages For Your Need

Dubai Honeymoon Packages

Starting from ₹ 12,822

India Dubai Tour Packages

Starting from ₹ 17,900

Dubai Turkey Tour Package

Starting from ₹ 82,000

Packages with Dubai

United Arab Emirates Packages

Other Packages You Might Like

Singapore Packages

Bangkok Packages

Phuket Packages

Krabi Packages

Pattaya Packages

Istanbul Packages

Tour packages for similar destinations

Sharjah Packages

Ras Al Khaimah Packages

Antalya Packages

Casablanca Packages

Miami Packages

Los Angeles Packages

Abu Dhabi Packages

Colombo Packages

Tel Aviv Packages

Honolulu Packages

Barcelona Packages

Tour packages for nearby destinations

Madinat Zayed Packages

Muscat Packages

Hanoi Packages

Top places for international vacation by months

  • October to March
  • April to September

FAQs on Dubai Tour Packages

How much is the burj khalifa ticket, which destinations are usually travelled together in dubai tour package, what are the best places to visit in dubai, is alcohol legal in dubai, how much does a dubai family tour cost, when is the cheapest time to travel to dubai, do indians need visa to go to dubai, how much does a dubai tour package cost, how much is a 5 day tour in dubai, which month is best to visit dubai, can you travel to abu dhabi with a dubai visa, how much does a 7-day trip to dubai cost, is dubai fun for couples, get the best offers on travel packages.

Compare package quotes from top travel agents

Compare upto 3 quotes for free

  • India (+91)

*Final prices will be shared by our partner agents based on your requirements.

Log in to your account

Welcome to holidify.

Forget Password?

Share this page

best dubai travel packages

Filter/Sort

  • < Back to Home
  • Destinations
  • Middle East
  • < Back to United Arab Emirates

Dubai’s city skyline bordered by the arabian desert

Dubai Vacations: Spectacular U.A.E.

Be prepared to get dazzled by Dubai. Everything in this second largest Emirate in the U.A.E. is super-sized, super luxurious and state-of-the-art. A cosmopolitan metropolis, Dubai attracts the most seasoned travelers from the world over. You could catch a show at the Dubai Opera, take a 4x4 ride over rippling sand dunes, dine at an upscale restaurant at Jumeriah Beach, ascend the world's tallest building, the Burj al Khalifa or ride a hot-air balloon over the Arabian desert. Our Liberty Travel consultants can customize your vacation package to this extraordinary destination.

Dubai vacations map

Dubai at a Glance

Currency: Dirham (AED)

Tipping Customs: 10-15% at restaurants is customary

Power Up: C, F, D, G (two and three-prong plugs), 220 V

Popular Drink: Qamardeen - a thick apricot drink

Must Eat: Camel-milk ice cream

Language: Arabic

Weather: Extremely hot in the summer to mild and pleasant in the winter.

Best Time to Visit: In the winter when the temperatures are milder.

Dubai Deals

Meet our dubai experts.

Lisa Siubis, travel agent

Lisa Siubis

best dubai travel packages

Amanda Araujo

Kathleen Romanishan, travel agent

Kathleen Romanishan

Lyndsay Roach, travel agent

Lyndsay Roach

Jesse Reason, travel agent

Jesse Reason

Diane Tortorelli, travel agent

Diane Tortorelli

Dubai’s impressive skyline from the coast

Top Things to Do in Dubai

Hop on a desert safari Go dune bashing in a 4x4, experience a camel desert safari, then go sand boarding down a sand dune…Dubai doesn’t get more thrilling than this.

Bargain-shop at the Gold Souk Haggle away at the traditional gold market with dazzling displays of jewelry in old Dubai to get the best price.

Top it off with Burj Khalifa Head 160 stories up to the observation deck of the tallest building in the world for stunning, panoramic views of magnificent Dubai.

Dine in style Sit down to a magical six-course dinner at Al Mahara at the Burj Al Arab Jumeirah, created by a Michelin-starred chef.

Tour traditional Dubai Get fascinated by Dubai's rich history and tradition as you visit the Al Fahidi Historical Neighborhood, Dubai Creek, and the Gold and Spice Souks.

A camel - a common motif in Dubai

Our Commitment to You

For over 70 years, the one-on-one personal experience has been at the very heart of Liberty Travel’s mission. It's what we've always done, and now it’s more important than ever.

We’re committed to serving you through:

  • GUIDANCE with our expert insight and travel knowledge.
  • VALUE with irresistible rates, offers and benefits.
  • PEACE OF MIND to book with confidence.
  • SERVICE by being by your side before, during, and after your trip.

Real people helping real people. Beside you every step of the way.

The Liberty Travel Experience

At Liberty Travel it’s the people who make a difference. Our travel experts craft the perfect trip for every traveler through our award-winning customer service. Real people helping real people. Beside you every step of the way.

Connect by Phone

Connect By Phone

Connect in Store

Connect In Store

Consultant Search icon

Connect With An Expert

Sponsored Vacations

World Travel Awards Winner 2023 seal

Winner of the World Travel Awards for United States' Leading Travel Agency

We are honored to be named United States’ Leading Travel Agency at the 30th annual World Travel Awards. Thank you for trusting us with crafting your incredible vacations.

Contact Form

Fill out the form below to get in touch with us.

Liberty Travel is dedicated to helping you get the best value and greatest experiences out of any trip. One of our Travel Consultants will respond to your enquiry within 1 business day.

If you would like to speak with a consultant now, please call 1-888-343-2128 .

A Liberty Travel consultant or one of our third party independent advisors who are part of our member network, Independent by Liberty Travel will contact you within 1 business day. If you would like to speak to a Liberty Travel consultant or one of our independent advisors now, please call 1-888-343-2128 . A non-refundable consulting deposit may be required to start the planning process for certain multi-city itineraries based upon complexity. This consulting deposit will be applied towards your final trip cost at the time of booking. You acknowledge that by submitting this inquiry form that your information may be disclosed to our third party independent advisors who are part of our member network, Independent by Liberty Travel for the purpose of facilitating your inquiry and your travel services booking. Accordingly, you are deemed to consent to the collection, use and disclosure of your personal information by us to our third party independent advisors who are part of our member network, Independent by Liberty Travel and relevant travel service providers for the purpose of facilitating your inquiry and your travel services booking and in accordance with the Liberty Travel Privacy Notice .

Feedback Form

  • Website Feedback
  • Service Feedback

Flight Centre Redirect Message

Flight Center is now Liberty Air Experts. Expect the same level of expertise on all varieties of flights, all around the world.

This store is now closed

The store you’re looking for is no longer open for business. Please try searching for another location near you. Thank you for your patience!

  • Experts Near Me
  • Destination Experts

Looking for a travel expert that’s close to you? Select your state.

Don't see your state? Select all states or select the state nearest to you.

Guidance

Expert insight & travel knowledge

Value

Irresistible rates, offers & benefits

Peace of Mind

Peace of Mind

Reassurance to book with confidence

best dubai travel packages

Beside you every step of the way

Which destination do you want your travel expert to specialize in?

Africa vacations

Booking 10 or more rooms?

New Hub Store Structure

Don't show me this again

Vacations in Dubai

Vacations in Dubai

Search hundreds of travel sites at once for vacation package deals in dubai.

Let KAYAK do the searching

Save on your next vacation

Search and compare hundred of travel sites at once for vacation packages in Dubai

We’re completely free to use - No hidden charges or fees

Filter by free cancellation, free breakfast and more

Cheap Dubai package deals

Most popular dubai flight and hotel deals, all inclusive vacation packages to dubai, last minute vacation packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in dubai, tips for finding dubai package deals.

  • There are loads of types of vacations in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travellers: Top vacation C$ 672; Family vacation C$ 589; Romantic vacation C$ 832; Luxury vacation C$ 787; Budget vacation C$ 520.

Why should you book a holiday package to Dubai?

With a good Dubai holiday package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven

When should you book a holiday package to Dubai?

The winter season in Dubai is the perfect time to take a holiday on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.

Where should you stay in Dubai during your holidays?

For any holiday type in dubai:.

Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.

Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.

For family holidays in Dubai:

The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.

Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.

For romantic holidays in Dubai:

Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.

Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.

For luxury holidays in Dubai:

With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.

The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.

For budget holidays in Dubai:

City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai holiday deals

Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.

Where to stay in Dubai

Dubai vacation information, other popular package vacation destinations.

  • Vancouver package vacations
  • Dublin package vacations
  • Montego Bay package vacations
  • Key West package vacations
  • Orlando package vacations

Deals of the Week   European Long Weekends   Up to 50% OFF

Dubai Tours & Trips

Find the right tour for you through Dubai. We've got 233 adventures going to Dubai, starting from just one day in length, and the longest tour is 147 days. The most popular month to go is October, which has the largest number of tour departures.

Filters applied

233 dubai tour packages with 230 reviews.

Magical Dubai Tour

Magical Dubai

Magical DUBAI was magical!! Good accommodations, food was good. A very knowledgeable guide that kept us informed and also well looked after. I would rate this tour as excellent. A 10+

The UAE Complete - Escorted Tour in 4* Hotels – Full Board Plan Tour

The UAE Complete - Escorted Tour in 4* Hotels – Full Board Plan

Tour bus audio system wasn't working properly so couldn't hear what tour guide was talking about.

Dubai Escape Tour

  • Christmas & New Year

Dubai Escape

It was a great experience. Everything was organized nicely.

The UAE Essentials - Escorted Tour in 4 Stars Hotels – Full Board Plan Tour

The UAE Essentials - Escorted Tour in 4 Stars Hotels – Full Board Plan

One of the precious travel memory in the travel life. Burj-Khalifa is really a wonder to the world. Desert safari could be more energetic. I also took a picture with the falcon on my shoulder. My brother recommended this package and guys I loved it.Good service, delicious food and good value of money.

Explore Dubai & Abu Dhabi 4 Nights 5 Days Tour

  • In-depth Cultural
  • Sightseeing

Explore Dubai & Abu Dhabi 4 Nights 5 Days

Fabulous tour exploring all the highlights of Dubai. We started with a tour of the Burj Khalifa the Worlds tallest building, unbelievable views from the top. We also had a very nice tour of Abu Dhabi which is famous for their delicious dates and sparkling blue waters of the Persian Gulf. We were also treated to a stunning cruise on Dubai Creek with its fantastic buffet and out of this world views. Very talented entertainment was also included. The grand finale of our tour was the Desert Safari with a tasty barbecue and thrilling entertainment including a fire breathing dancer. I just cannot express how grand this tour was. Thank You

Dazzling Dubai Tour

Dazzling Dubai

I did the Dubai/Abu Dhabi trip in October 2018. I was shocked that all was seamless. The choice of hotels were top notch. Our travel rep in Dubai/Abu Dhabi was so knowledgeable and helfpul. Really, nothing negative to say. Only comment but this is more of a personal preference, I would have rathered spent the entire time in Dubai with a 1 day excursion to Abu Dhabe as opposed to splitting it up as there is more to do in Dubai. I was impressed as were my travel buddies.

3 Days Private 4*Couples Tour Full Day Old & New Dubai + Private Desert Safari+ Full Day Abu Dhabi Tour Tour

3 Days Private 4*Couples Tour Full Day Old & New Dubai + Private Desert Safari+ Full Day Abu Dhabi Tour

Amazing Abu Dhabi and Dubai Tour

Amazing Abu Dhabi and Dubai

We got more than we expected great value for money.will travel with Indus again

Dubai Luxury Holidays Package 6 Night 7 Days Tour

Dubai Luxury Holidays Package 6 Night 7 Days

Great tour! Well organised and stress free! I would really recommend JTR Holidays! Thank you!!

Stars of Dubai - 6 days Tour

Stars of Dubai - 6 days

All of the tour guides were excellent and very knowledgeable. My only issues were that we paid for a 5 star hotel and we got a 4 star hotel. I let a representative know about this hotel discrepancy and nothing was done or corrected. It was never addressed. Also, we were not informed that we would not be seeing certain listed sites until I asked why we didn't see them. I was then told they were closed due to Covid. Those sites are still listed in the online brochure and thus included in the price.

Customized Private Dubai & Abu Dhabi Vacation with Daily Departure Tour

Customized Private Dubai & Abu Dhabi Vacation with Daily Departure

  • Book With Flexibility This operator allows you to rebook your dates or tours with them for free, waiving change fees.

Dubai and Burj Khalifa - 5 days Tour

Dubai and Burj Khalifa - 5 days

This tour was well-run, as described, friendly and efficient. I was lucky in that all the various other people I met on these excursions were really nice, but equally so were the various guides. I happily recommend this company.

Ferrari World Adventure 5 Days/ 4 Nights Tour

Ferrari World Adventure 5 Days/ 4 Nights

Dubai tour was generally amazing! Our guide could speak in both English and French. We enjoyed every moment of it and look forward to booking again next year with Across Africa Tours and Travel.

DUBAI – Skyscrapers Desert Abu Dhabi with Oman Highlights Tour

DUBAI – Skyscrapers Desert Abu Dhabi with Oman Highlights

09-Day Dubai Family Explorer tour Tour

09-Day Dubai Family Explorer tour

What people love about dubai tours.

Sehr viel gesehen, sehr gute Organisation, gutes Essen, ausgezeichneter Reiseleiter, insgesamt sehr zufriedenstellend. Allerdings: Beworben wurde die Reise mit einer maximalen Gruppengröße von 20 (!), was ein wesentliches Motiv für die Buchung war. Tatsächlich war die Gruppengröße 39 - 41, also doppelt so groß!!!! Wie vertrauenswürdig sind eigentlich die Angaben zur Reise? Wäre die Gruppengröße mit max 40 Personen angegeben gewesen hätten wir diese Reise NICHT GEBUCHT!
Tour bus audio system wasn't working properly so couldn't hear what tour guide was talking about.

Tours starting from Dubai

  • for 7 Days (64)
  • for 10 Days (20)
  • for 2 Weeks (20)
  • for 3 Days (7)
  • for 3 Weeks (5)
  • to Asia (109)
  • to United Arab Emirates (92)

International Versions

  • Deutsch: Dubai Rundreisen
  • Français: Circuits et voyages au Dubaï
  • Español: Circuitos y viajes por Dubai
  • Nederlands: Dubai Rondreizen

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

  • The Americas
  • The Middle East
  • Asia & South Pacific
  • Festive Offers
  • Holidays 2024

Dubai Holiday Offers

  • Last Minute Escapes
  • Atlantis The Palm Offers
  • Ras Al Khaimah Holidays

Middle East

  • Ras Al Khaimah

Indian Ocean

  • All-inclusive Holidays
  • Beach Holidays
  • Business Class Holidays
  • Family Holidays
  • Luxury Holidays
  • Winter Sun Holidays
  • London Heathrow
  • London Gatwick
  • London Stansted
  • Additional Services
  • In-Resort Service
  • Opening Hours
  • Pay My Balance
  • 020 8972 8951
  • Flight + Hotel

Search Holidays

  • Manage My Booking
  • London - All Airports
  • London Gatwick (LGW)
  • London Heathrow (LHR)
  • London Stansted (STN)
  • Birmingham (BHX)
  • Manchester (MAN)
  • Newcastle (NCL)
  • Glasgow (GLA)
  • Edinburgh (EDI)

Dubai is home to a world of wonders for those adventurous to discover it. With something for every kind of traveller, Dubai is perfect for your next holiday. For those looking for a relaxing retreat, you will find some of the world’s best resorts, whether on the iconic Palm Jumeirah , bustling Downtown Dubai , the world-famous Jumeirah Beach or enjoying cafe culture along The Walk . Thrill-seekers will be in their element, with a plethora of high-octane theme parks and water parks, such as Dubai Parks and Resorts, Aquaventure Waterpark, IMG Worlds of Adventure, Wild Wadi Waterpark and so much more. It doesn’t stop there though; you could be racing down the slopes of Ski Dubai , reaching the dizzying heights of the world’s tallest building at the Burj Khalifa or soaring high above Dubai on a Seawings Seaplane Tour . Experience this and so much more on your next getaway. Find out more about a tantalising holiday in Dubai here .

Beyond that, Dubai is also home to the world’s largest shopping mall, The Dubai Mall , with more than 1,000 designer stores and boutiques where you’re guaranteed to find presents for all the family (or yourself). Aside from the largest mall in the world, Dubai also has a variety of bustling, traditional souks and shopping centres to cater for everyone’s shopping needs.

View our Dubai holiday offers below and book today to enjoy guaranteed savings, low deposits from £100, complimentary meal and room upgrades and many more extras to make your next Dubai holiday truly special. Book online or call us for more information on 020 8972 8951 .

best dubai travel packages

  • Three complimentary sessions at Atlantis Explorers Club and The Zone

Atlantis, The Palm, Dubai

  • 5 nights from £2,049pp
  • Ocean Room Queen
  • Travel on selected dates from 24 to 30 October 2024
  • Return Emirates flights from London Gatwick
  • Price based on 2 adults and 2 children

Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.

best dubai travel packages

  • Kids Eat and Stay Free

The Ritz-Carlton Dubai

  • 5 nights from £1,629pp
  • Half Board Dine Around
  • Deluxe Room
  • Return Emirates flights from London Heathrow

best dubai travel packages

  • Unlimited access to Wild Wadi Waterpark

Jumeirah Beach Hotel, Dubai

  • 5 nights from £1,929pp
  • Deluxe Room Ocean with Balcony
  • Return Emirates flights from Manchester

best dubai travel packages

  • Complimentary Half Board upgrade

Anantara The Palm Dubai Resort

  • 5 nights from £1,195pp
  • Deluxe Lagoon View Room
  • Travel on selected dates from 01 to 30 October 2024
  • Return Emirates flights from Birmingham

best dubai travel packages

  • Access to Jungle Bay waterpark

The Westin Dubai Mina Seyahi Beach Resort & Marina

  • 5 nights from £1,219pp
  • Deluxe Skyline
  • Return Emirates flights from Glasgow

best dubai travel packages

  • Kids Eat Free

Lapita, Dubai Parks and Resorts, Autograph Collection

  • 5 nights from £939pp
  • Half Board Plus
  • Deluxe Twin Room Resort View with Park access
  • Return Emirates flights from Newcastle

best dubai travel packages

Dubai Family Holidays

best dubai travel packages

Luxury Dubai

best dubai travel packages

Desert Escapes

best dubai travel packages

Downtown Dubai

best dubai travel packages

Explore Dubai

best dubai travel packages

All-inclusive Dubai

best dubai travel packages

Dubai Beach Holidays

best dubai travel packages

Dubai City Breaks

Join the emirates holidays community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Holidays?

  • Personalised holidays
  • Support at every step
  • Get more for your money
  • Fly Better with Emirates
  • Enjoy rewards with Emirates Skywards

For more information, please click here

  • Recent Hotels 0 You do not have any recently viewed hotels.
  • Shortlist 0 Your hotel shortlist is empty!
  • Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

Expedia Rewards is now One Key™

best dubai travel packages

Dubai All inclusive Vacations

Book an all inclusive hotel + flight or car together to unlock savings.

I only need accommodations for part of my trip

  • payments icon Better together Save up to $580 when you book a flight and hotel together*
  • lob hotels icon Find the right fit With over 300,000 hotels worldwide, it's easy to create a perfect package
  • lob packages icon Rest easy Plan, book, and manage your trip all in one place

Top All inclusive vacation packages in Dubai

JA The Resort - JA Palm Tree Court

JA The Resort - JA Palm Tree Court

Reviewed on Mar 18, 2024

JA The Resort - JA Beach hotel

JA The Resort - JA Beach hotel

Reviewed on Feb 13, 2024

Rixos The Palm Hotel & Suites

Rixos The Palm Hotel & Suites

Reviewed on Feb 18, 2024

Atlantis, The Palm

Atlantis, The Palm

Reviewed on Apr 5, 2024

Al Maha, A Luxury Collection Desert Resort & Spa, Dubai

Al Maha, A Luxury Collection Desert Resort & Spa, Dubai

Reviewed on May 3, 2023

5* All inclusive vacations in Dubai

3 night all inclusive vacations in dubai, 4 night all inclusive vacations in dubai, all-inclusive dubai vacations: everything you need to know, can i book a dubai vacation with airfare and meals.

On an all-inclusive vacation, your mind and body can wander far from your wallet. Pay one simple price when you bundle your accommodation and airfare, and you avoid all those yucky bills after conversation-starting cocktails or decadent dinners.

How can I find Dubai all-inclusive vacations that are adults only?

All the best all-inclusive, all-adult vacations are a click of a filter or two away. Choose from great grown-up features. Say, a spa for a couple’s massage, a hot tub to soak away the stresses of the day, or a swim-up bar to get the party started.

How much is an all-inclusive trip to Dubai?

Affordable all-inclusive is yours, whatever your budget. Packages start tempting you from just $622. Prices and availability are subject to change. Additional terms may apply.

How can I book cheap all-inclusive trips to Dubai?

Whenever you book your travel, sorting by price and filtering by budget shows you what’s out there in your price range.

What are the benefits of all-inclusive Dubai vacations with airfare?

Create your dream getaway by bundling your flight and hotel and you get delightful deals and discounts. Add your car rental, too, and you save on all three.

What should I think about when I book an all-inclusive Dubai family vacation package?

With little tummies taken care of, you just need to put smiles on their faces. Easy! Book an all-inclusive vacation with a full-on water park or epic pools—or book your stay near the world’s biggest theme parks and attractions.

Why should I book an all-inclusive honeymoon package in Dubai?

You can start your married life how you mean to go on with an all-inclusive honeymoon package. Eat and drink to your heart’s content, waltz around in happy harmony, and have your fill of delights. Together, you can book up adventure excursions and return to a pool-side cabana for cocktails at sunset.

Can I book an all-inclusive Dubai package with free cancellation and/or flexible dates?

When you’re searching for your all-inclusive getaway, filter your results by payment option to find free cancellation and buy now, pay later options. That way, you can rebook without worry, should your plans change.

Why should I book an all-inclusive Dubai package vacation with Expedia?

Book amazing all-inclusive adventures, all in one place. Choose from a vast inventory of deals, adding every little extra to build your brilliant break in minutes.

Top All inclusive Dubai Hotels

Le Méridien Mina Seyahi Beach Resort & Waterpark

  • 28 min drive from Burj Khalifa

NH Collection Dubai The Palm

  • 27 min drive from Burj Khalifa

Reviewed on Mar 30, 2024

Centara Mirage Beach Resort Dubai

  • 18 min drive from Burj Khalifa

Reviewed on Apr 4, 2024

best dubai travel packages

All Inclusive Vacations

best dubai travel packages

Beach Vacations

best dubai travel packages

Kid Friendly Vacations

best dubai travel packages

Golf Vacations

best dubai travel packages

Luxury Vacations

best dubai travel packages

Romantic Vacations

best dubai travel packages

Ski Vacations

LGBTQ+ Vacation Packages

LGBTQ+ Vacations

best dubai travel packages

Adventure Vacations

Where to go when

Where to go when

Top all inclusive vacation destinations.

  • Caribbean All Inclusive Vacation Packages
  • Puerto Rico All Inclusive Vacation Packages
  • USA All Inclusive Vacation Packages
  • Maldives All Inclusive Vacation Packages
  • Fiji All Inclusive Vacation Packages
  • Aruba All Inclusive Vacation Packages
  • Thailand All Inclusive Vacation Packages
  • Bahamas All Inclusive Vacation Packages
  • Cancun All Inclusive Vacation Packages
  • Mexico All Inclusive Vacation Packages
  • Bora Bora All Inclusive Vacation Packages
  • Hawaii All Inclusive Vacation Packages
  • Jamaica All Inclusive Vacation Packages
  • Florida All Inclusive Vacation Packages
  • Costa Rica All Inclusive Vacation Packages
  • Las Vegas All Inclusive Vacation Packages
  • Punta Cana All Inclusive Vacation Packages
  • Cabo San Lucas All Inclusive Vacation Packages
  • Dominican Republic All Inclusive Vacation Packages
  • Puerto Vallarta All Inclusive Vacation Packages

More Vacation Ideas

  • Travel Planning Center
  • Ticket Changes & Refunds
  • Airline Partners
  • Check-in & Security
  • Delta Sky Club®
  • Airport Maps & Locations
  • Flight Deals
  • Flight Schedules
  • Destinations
  • Onboard Experience
  • Delta Cruises
  • Delta Vacations
  • Shop Hotels
  • In-Flight Wi-Fi
  • Trip Protection
  • How to Earn Miles
  • How to Use Miles
  • Buy or Transfer Miles
  • Travel with Miles
  • SkyMiles Partners & Offers
  • SkyMiles Award Deals
  • SkyMiles Credit Cards
  • SkyMiles Airline Partners
  • SkyMiles Program Overview​
  • How to Get Medallion Status​
  • Benefits at Each Tier
  • News & Updates
  • Help Center
  • Travel Planning FAQs
  • Certificates & eCredits
  • Accessible Travel Services
  • Child & Infant Travel
  • Special Circumstances
  • SkyMiles Help

Dubai Vacation Packages

Explore dubai.

Ski or skate indoors, shop 'til you drop, sail over sand dunes, or simply sit and admire the jaw-dropping skyline. Don’t miss seeing the spectacular desert scenery on the outskirts of the city, which is a familiar reminder of the Bedouins, who once wandered this stretch of land.

Explore some of the city’s most iconic spots like Old Town to learn something new. Walk among the wind towers of the Al Fahidi neighborhood. Head to an Arabian Tea House for some Emirati cuisine. It's all in Dubai, and if it's not, it’s probably in the plans.

Recognized for its award-winning architecture and luxury living, Dubai offers something new to explore around every corner.

Whether it’s for dune buggy driving, sandboarding, camelback tours or more, the Dubai desert offers a variety of exciting activities just a short drive from the heart of the city.

Enjoy a taste of Arabian hospitality, up-close city views and the serenity of the Dubai Marina aboard a dhow dinner cruise boat.

  • Dubai Escapes Slide 2 of 3: Whether it’s for dune buggy driving, sandboarding, camelback tours or more, the Dubai desert offers a variety of exciting activities just a short drive from the heart of the city.
  • Dhow Cruise Slide 3 of 3: Enjoy a taste of Arabian hospitality, up-close city views and the serenity of the Dubai Marina aboard a dhow dinner cruise boat.

For the ultimate family break, IMG Worlds of Adventure combines the Hulk with The Powderpuff Girls, Captain America and Iron Man, hair-raising roller coasters and erupting volcanoes for one extraordinary experience. Indoors, the Leap of Faith at the Atlantis on Palm Jumeirah, the Wild Wadi Water Park and indoor skiing inside the Mall of the Emirates are some of the most exceptional and interesting ways to spend any vacation.

One of Dubai’s truly authentic experiences is its emerging Al Quoz arts district. Here, art meets fashion and design in a most unusual way. Its central hub, Alserkal Avenue, offers edgy art events, concept spaces, endless pop-up concerts and avant-garde galleries. From contemporary and emerging artists to new movers and shakers, a visit to this artsy district is worthy of your attention.

For outdoor adventure, go on a sunset desert safari, see the city skyline from a helicopter, hit the greens on the world’s most beautiful courses, or jump into a 4-wheel drive to explore the steep canyons and soaring peaks of the Hajar Mountains. If you’re a nature lover, get lost in a one-of-a-kind world of wonderment with a visit to a mega garden in the middle of the desert — the Dubai Miracle Garden.

With the largest shopping mall in the world, Dubai is often referred to as "Do-Buy." In the malls, you'll find numerous and familiar name brands, the finest in luxury brands, and often an area with local items including silk, shawls, scarves, beads, antique silver and beautifully embroidered clothing. Gold lovers will be nearly blinded by the hundreds of shops in the Gold Souk, located on the north side of Dubai Creek. Culture seekers can travel back in time to the hidden mountain village of Hatta, known for its ancient fort and village, dating back centuries. 

Foodies can feast on Indian and Middle Eastern dishes, celebrity-chef creations, traditional Emirati Street eats and more. There’s a taste or treat to satisfy every palate in Dubai.

As a Muslim country, the sale and consumption of pork is regulated in Dubai and is sold only to non-Muslims, so don't expect to see any on the menu. The sale of alcoholic beverages is also regulated. You need a permit to buy it in specially controlled liquor stores; however, anyone of age can purchase a drink in the bars and restaurants found within the hotels.

Delta Vacations packages include round-trip flights aboard a Delta Global Partner airline to Dubai International Airport (DXB). Round-trip transfers between the airport and hotels are available for purchase.

Learn more about the official vacation provider of Delta Air Lines.

best dubai travel packages

Your elevated vacation experience starts here. Choose from flights, hotels, rides and activities all over the world, all in one place.

best dubai travel packages

WE’RE HERE FOR YOU

As trusted experts, we’ll help with recommendations, booking and support — whenever and wherever you need it.

best dubai travel packages

PREFERRED BY SKYMILES® MEMBERS

We make it easier to  get more from your miles while also  earning bonus miles  and earning toward Medallion® Status.

best dubai travel packages

TRAVEL WITH CONFIDENCE

Things come up, and we’ve got you covered, from  flexible changes   and cancellations to  travel protection plans .

  • Investor Relations
  • Business Travel
  • Travel Agents
  • Comment/Complaint
  • Browser Compatibility
  • Accessibility
  • Booking Information
  • Customer Commitment
  • Tarmac Delay Plan
  • Sustainability
  • Contract of Carriage
  • Cookies, Privacy & Security
  • Human Trafficking Statement (PDF)

Holidays in Dubai

Holidays in Dubai

Search hundreds of travel sites at once for holiday package deals in dubai.

Let KAYAK do the searching

Save on your next holiday

Search and compare hundred of travel sites at once for holiday packages in Dubai

We’re completely free to use - No hidden charges or fees

Filter by free cancellation, free breakfast and more

ATOL Protected: All packages are ATOL protected

Cheap Dubai package deals

Most popular dubai flight and hotel deals, all inclusive holiday packages to dubai, last minute holiday packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a holiday in dubai, tips for finding cheap holiday packages dubai.

  • There are loads of types of holidays in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travellers: Top holiday £355; Family holiday £319; Romantic holiday £443; Luxury holiday £413; Budget holiday £250.

Why should you book a holiday package to Dubai?

With a good Dubai holiday package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven

When should you book a holiday package to Dubai?

The winter season in Dubai is the perfect time to take a holiday on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.

Where should you stay in Dubai during your holidays?

For any holiday type in dubai:.

Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.

Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.

For family holidays in Dubai:

The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.

Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.

For romantic holidays in Dubai:

Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.

Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.

For luxury holidays in Dubai:

With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.

The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.

For budget holidays in Dubai:

City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai holiday deals

Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.

Where to stay in Dubai

Dubai holiday information, other popular package holiday destinations.

  • Paphos package holidays
  • Vancouver package holidays
  • Dublin package holidays
  • Montego Bay package holidays
  • Copenhagen package holidays
  • Venice package holidays
  • Berlin package holidays
  • Abu Dhabi package holidays
  • Myrtle Beach package holidays
  • Key West package holidays
  • Orlando package holidays
  • Sharjah package holidays
  • Ajman package holidays
  • Ras al-Khaimah package holidays
  • Dubai package holidays

THE 10 BEST All Inclusive Hotels in Dubai

best dubai travel packages

Dubai All Inclusive Hotels

Property types, distance from, neighborhoods, traveler rating, hotel class.

  • Best Value Properties ranked using exclusive Tripadvisor data, including traveler ratings, confirmed availability from our partners, prices, booking popularity and location, as well as personal user preferences and recently viewed hotels.
  • Traveler Ranked Highest rated hotels on Tripadvisor, based on traveler reviews.
  • Distance to city center See properties located closest to the center first with confirmed availability for your dates from our partners

Exterior

1. Rixos The Palm Hotel & Suites

The Waterpark

2. Centara Mirage Beach Resort Dubai

Hotel Exterior

3. Kempinski Hotel Mall Of The Emirates

Pool - outdoor

4. JA Lake View Hotel

Garden Terrace Junior Suite

5. JA Palm Tree Court

best dubai travel packages

6. Hotel Riu Dubai

Bedouin Suite Private Pool

7. Al Maha, a Luxury Collection Desert Resort & Spa, Dubai

Exterior

8. JA Beach Hotel

best dubai travel packages

9. Sheraton Jumeirah Beach Resort

The Deluxe Room at the Ramada Hotel Dubai

10. Ramada Hotel Dubai

11. panorama grand hotel, all inclusive hotels nearby destinations.

best dubai travel packages

Popular destinations for All Inclusive Hotels

best dubai travel packages

Popular Dubai Categories

best dubai travel packages

Pullman Resort Al Marjan Island

Rixos bab al bahr, doubletree by hilton resort & spa marjan island, the cove rotana resort, al hamra residence, bm beach hotel, bm beach resort, ramee rose hotel, al jawhara hotel apartments, ramada by wyndham downtown dubai, conrad dubai, kempinski central avenue dubai, le royal meridien beach resort & spa, raffles dubai, sofitel dubai jumeirah beach, jw marriott marquis hotel dubai, the meydan hotel, mövenpick hotel jumeirah beach, address downtown, all inclusive hotels information.

New Delhi to Dubai

  • Dubai Tour Packages
  • 63 / 63 Package s

Explore the land of adventure

SEARCH THIS PAGE:

About Dubai Tour Packages

Browse other top International Holiday packages by Theme : International Tour Packages , International Honeymoon Packages , International Cruise Packages , International Beach Packages , International Family Packages , International Adventure Packages , International Luxury Packages , International Leisure Packages , International Pilgrimage Packages , International Wildlife Packages

Best Dubai Tour Packages in 2024

More about dubai tour packages:- .

Dubai, the largest and most populous city in the UAE , is the embodiment of dreams turning into reality and the favourite destination for many travellers. Synonymous with tall ultramodern skyscrapers juxtaposed with charming heritage, Dubai appeals to the traveller’s senses. From luxury shopping to imposing desert landscapes, from world famous restaurants and hotels to theme parks with the most thrilling rides, a Dubai trip has something to suit every kind of traveller. Whether you are looking for a Dubai honeymoon package, a family holiday or a quick getaway with friends, the various Dubai attractions will be sure to leave you spellbound.

Geographically, Dubai is located in the Middle East on the south-east coast of the Persian Gulf. It is the capital of the Emirate of Dubai, one of the seven that make up the United Arab Emirates. The currency of  Dubai is UAE Dihram - AED. This global city is a major aviation and financial hub. Dubai has gradually transitioned into a global icon of engineering and construction with the world’s tallest building, the Burj Khalifa marking the skyline of the city. Dubai tourism is greatly promoted by the government; its ancient and modern attractions never fail to lure in tourists all around the year.    

Best time to visit Dubai

Dubai weather is classified into hot and hotter with dry desert winds. If you are planning a Dubai trip, it is best to avoid the dry and hotter months of April to September. The best time to visit Dubai is during the winter months of November to March, Dubai weather in november when the skies above are clear blue and the beach below sports wonderful weather. Sun seekers and beach lovers can enjoy the sunny side of Dubai winters, while the shoppers will love the Dubai Shopping Festival that is usually held from December to February.

Expect some rainfall from January to March, which is a part of the Dubai climate for these months. During the summer months of April to October, you can escape the crowds and also find a hotel room with ease. Dubai hotels will be relatively cheap in these months, since this is the summer season, although everywhere indoors will be comfortably air-conditioned. If you are looking for cheap Dubai tour packages, just book the best Dubai holiday packages that MakeMyTrip rolls out for this off-season period for Dubai tourism.

How to reach Dubai

The best way to reach Dubai is via flight. Flights to Dubai link the Emirate with over 200 world destinations. You can land directly at the Dubai International Airport, the largest airport in the UAE and one of the busiest airports in the world. Another way to reach Dubai by air is via the Sharjah International Airport and transfer to Dubai by road on a taxi or bus service.

If you are travelling to Dubai from one of the other cities of the Emirates, you can use the Emirates Express bus services to Dubai. These buses connect Dubai with Sharjah, Abu Dhabi etc.

If you have booked your Dubai trip from India, then you can fly to Dubai from any of the major Indian cities. Flights to Dubai from India are operated by multiple airlines like Emirates, Air India, Air India Express, SpiceJet, Indigo and Fly Dubai among others. Air Arabia operates flights from India to Sharjah. A non-stop Delhi to Dubai flight can be booked on SpiceJet, Indigo, Fly Dubai, Air India, Air India Express, Emirates and Hahn Air, while direct flights to Dubai from Bangalore are operated by Indigo and Emirates. Similarly, non-stop flights to Dubai from Mumbai are available on nearly all airlines – SpiceJet, Indigo, Fly Dubai, Air India, Air India Express, Emirates, and Hahn Air.  All the major Indian cities are similarly connected to Dubai through these hubs.

With so many flights to Dubai from India, booking Dubai holiday packages from India is as simple as logging on to the MakeMyTrip website! Browse MakeMyTrip to explore the best of Dubai’s tourist places and book from a range of Dubai trip packages. If you are on your honeymoon, there is a ready selection of Dubai honeymoon packages with the best hotels and inclusions picked for you.

Plan your Dubai getaway with MakeMyTrip! Easily convert AED to INR for our holiday packages. Explore UAE hassle-free with our convenient currency conversion feature. Book now and embark on your dream trip!

Places to visit in Dubai

Dubai is like a glittering oasis in a desert landscape. When you are approaching by road, the towering Burj Khalifa pierces the skyline, slowly guiding you into the city. As you approach Dubai via air, a shimmering display of the glass buildings towering up from the ground below will take your breath away. Enjoy the visual delights as the top Dubai attractions come into sight as your plane eases in for the airport. The Burj Khalifa stands tall like a giant obelisk, while the Burj Al Arab further away resembles a masted ship ready to set off to sail. The artificially reclaimed lands of Dubai Palm Islands and the World Islands will leave you awed.  

To allow you to make the most of your Dubai trip, here is our recommended list of unmissable places to visit in Dubai

  • Burj Khalifa

We recommend that you start your Dubai tour with the tallest free-standing man-made structure at 828m high, the Burj Khalifa. You can visit this marvel of engineering either during the day, or wait till evening for its light shows to begin. Take the world’s fastest double-deck elevators to go up to the Burj Khalifa Observation Deck on Level 124 or right up till Level 148 to discover Dubai with a stunning overview of the cityscape. The Burj Khalifa observation deck is the highest outdoor observation deck in the world. This is by far the leader amongst all Dubai attractions, popular with travellers of all kinds.

Located very close to the Burj Khalifa , the Dubai Mall is one of the most popular places to visit in Dubai. This is the second-largest shopping mall in the world by total land area, and is also the home of the famous Dubai Shopping Festival. Apart from being able to spend hours shopping for every conceivable brand in over 1200 stores, shoppers can also spend time here at an ice skating rink, a cinema theatre, a theme park, aquarium and more.

Dubai Aquarium

Located within the Dubai Mall, the Dubai Aquarium is a commonly included part of a Dubai city tour especially for families. The world’s largest suspended aquarium, it holds over 140 species of aquatic animals including rays and sharks. Walk through the 48m long tunnel that will give you a stroll beneath the largest collection of sand tiger sharks in the world. With over 33,000 aquatic animals, sand tiger sharks and sting rays swimming above you, the view will simply astound you. Visitors can also visit the Underwater Zoo on a higher level in the same mall, where in three different ecosystems, a variety of creatures like Piranha, Penguin, Otters, African Crocodile, and Lionfish etc. This is one of the Dubai tourist places that is likely to appeal to all members of the family.

Ferrari World

Ferrari World Abu Dhabi is a theme park located on Yas Island in Abu Dhabi, a short drive away from Dubai. A visit to Ferrari World is high up on the list of many travellers booking Dubai holidays. You can book this activity as a part of your Dubai package from MakeMyTrip. Visitors can enjoy the range of 37 rides and shows at Ferrari World, including the world’s fastest roller coaster, the Formula Rossa. There are plenty of things for young kids to do at Ferrari World too, in areas like the Adventureland and the Car Wash. 

Dubai Frame 

The latest amongst the list of Dubai tourist places is the Dubai Frame, located within the Zabeel Park. This monument is shaped like a giant ornate picture frame, and provides an insight into the past, present and future idea of Dubai. While the Old Dubai gallery shares information about Dubai’s past through interactive displays and 3D technology, at the Sky Deck level the present Dubai view is shown through a panoramic viewing gallery enhanced by various augmented reality effects. The Future Dubai gallery uses a combination of specially produced audio and video effects to create an image of a possible future Dubai. The entire visit is quite a unique experience.

Dubai Parks and Resorts

Dubai Parks and Resorts is the largest integrated theme park and leisure destination within the Middle East. This is fast becoming an essential inclusion for Dubai packages, especially if you are travelling to Dubai with family. The various theme parks here include - Motiongate Dubai , a Hollywood-themed amusement park; Bollywood Parks Dubai , which is the world’s first Bollywood-themed park and has 5 different zones; Legoland with its Lego-themed rides, shows and attractions perfect for families with younger children; and the Legoland Waterpark which is the world’s only waterpark designed especially for children aged 2 to 12 year old and their families. A visit to Motiongate Dubai or any of the other parks within Dubai Parks and Resorts can be pre-arranged as a part of MakeMyTrip’s Dubai holiday packages.

Atlantis the Palm - Aquaventure & Lost Chambers 

Atlantis the Palm is a luxury hotel on the Palm Jumeirah in Dubai and undoubtedly one of the most coveted places in Dubai to stay in. While this luxury Dubai hotel would be a bucket list place to stay for many, even if you are not staying at the Atlantis Dubai you can spend time here at the Atlantis waterpark. The Atlantis Aquaventure Waterpark offers over 30 thrilling water slides and attractions, interconnected river rides, cownose ray feeding, underwater adventures, splash zones for younger children. The waterpark even has a private beach for the benefit of visitors. You can combine your Aquaventure trip with a visit to the Lost Chambers Aquarium , which is the largest aquarium in the UAE with over 65,000 marine animals displayed here. Apart from viewing the exhibits, visitors can also participate in the daily feeding shows and go diving or snorkelling among the fish.  

Dubai Fountain

Enjoy the evening of your visit to the Dubai Mall by witnessing the Dubai Fountain display with light and water jets shooting up as high as 150m in synchronous patterns. A water dance doesn’t get better than this.  This is the next level of a water fountain!

What to eat in Dubai

From international cafes to restaurants specializing in Emirati cuisines to celebrity chefs cooking up a storm every day, there is a wide-array of culinary options to choose from in Dubai. Eat out at celebrity restaurants or enjoy a meal in a family friendly and instagrammable location.

Here are some tips on the best food in Dubai and how to enjoy it:

Street food: If you enjoy non vegetarian food, try some of the street food in Dubai’s Bur Dubai or Deira areas. Dubai’s traditional pizza, called Manousheh , is a delicious flatbread topped with salty Akkawi cheese, zaatar herbs and olive oil. Best had for breakfast, it comes along with a creamy labneh, jam, minced lamb and eggs. This is probably the best street food in Dubai! If you like spice, you can also try the Lahem Bl Ajin , Lebanese bread with spiced ground meat topping also known as “Arabian pizza”.

Traditional specialties: The famous Chelo Kebab is a combination of kebabs served with saffron-scented basmati rice, with a pat of butter added on. Likewise, Shish Tawook is a kebab served in traditional style and sandwiched in bread, while Al Machboos is a popular dish of rice and meat cooked together in one pot. Al Harees is a dish saved up for weddings, Ramadan and Eid in Dubai. Meat and wheat are baked together into a salty delight; you can’t stop at one.

Sweet delights: While on your Dubai trip, try some of the local sugary concoctions such as Luqaimat , a deep fried Ramadan special dumpling made of milk, sugar, flour, butter, cardamom and saffron. You can also try the Kanafeh , a traditional dessert made of rose syrup and sweet cream cheese and topped with chopped pistachios.

Vegetarian food in Dubai: Apart from Indian food, you can also try some local vegetarian specialties in Dubai, such as Tabbouleh which is made from tomatoes, green onions, cucumber and seasoned with lemon and fresh mint, or the Fattoush salad made with fried or toasted Pita bread pieces complemented with a lemon dressings and greens. Most of the hotels offered in MakeMyTrip’s Dubai packages will also arrange vegetarian food if requested in advance.

Indian restaurants in Dubai: Dubai has a large number of Indian restaurants to suit all budgets. Some of the more famous ones include Bombay Brasserie, Khyber, Indego by Vineet, Chutney’s, Gazebo, Mint Leaf, Chor Bazaar, etc.

If you are in for some experimenting, you can try a variety of street food in Deira, explore beachside eateries at Kite Beach, or enjoy a lavish dinner at a rooftop restaurant in Dubai Marina. With people of many different nationalities residing in Dubai, adding to its cuisines, there are a wide variety of flavours to enjoy here.

Fun things to do in Dubai

The regular Dubai sightseeing covers the most popular places to visit in Dubai through a half-day or full-day Dubai city tour. For something more, there are a number of interesting and fun things to do in Dubai for travellers of all kinds.

Desert Safari with BBQ dinner

Add a thrilling element to your Dubai holiday package with a memorable Desert Safari along with your friends and family. Travel out from Dubai to the golden dunes outside the city, in a 4X4 vehicle with an experienced driver. Enjoy an adrenalin-pumping off-road dune bashing session of 30 to 40 minutes, and take gorgeous pictures of the sunset. Continue to a desert camp where you will enjoy a delicious barbecue dinner along with musical entertainment under the stars. 

Ski Dubai 

Ski Dubai, the first indoor ski resort in the Mid-East, is located inside the Mall of the Emirates, one of the most famous places in Dubai. This is the perfect place to visit in Dubai for a day of fun with your family. No matter what the weather outside is, Ski Dubai will always be a fantastic sub-zero winter wonderland covered with snow! Here, you can try skiing and snowboarding at 5 different slopes for varying levels of expertise. Ski Dubai also offers classes with professional instructors. There is also a 4500 sq. m. Snow Park, with activities like tobogganing, tubing, zorbing, wall climbing, bob sled rides, and snow play zones. Children will love the Penguin Colony at Ski Dubai, where they can meet King and Gentoo Snow Penguins.

Dhow Marina Cruise

The Dhow cruise is one of the most popular things to do in Dubai for most travellers visiting for the first time. The Dubai Marina, the world’s largest man-made marina, is a peaceful canal lined with famous skyscrapers like the Dubai Marina Mall and the Burj Al Arab. Sailing on the canal on a traditional wooden boat called “Dhow” is a wonderful experience. You will not only enjoy the boat cruise, but also get a great perspective of the wondrous architecture of the area from the boat accompanied by the sound of traditional music in the background. Depending on your preference, you can book a Dhow Cruise with Dinner, or a Sunset Dhow Cruise, or just a regular daytime cruise. Whichever Dhow Marina Cruise you book for your Dubai trip, you are sure to have a great experience!

This almost did not need to be said. Dubai and shopping go hand in hand! Whether you prefer to shop at the upscale Dubai malls such as the Dubai Mall, the Mall of the Emirates, and the Mercato Mall, go bargain hunting at the Dubai Outlet Mall, or stock up on jewellery at the Gold Souk Dubai, Dubai has a lot to offer the serious shopper. If you are looking for traditional products like textiles, ceramics, handicrafts, spices and other souvenirs to bring back from your Dubai holiday, we highly recommend a visit to Meena Bazaar in the Bur Dubai area. This is one of Dubai’s famous places for traditional shopping. If you are a really committed shopper, do consider booking your Dubai trip package to coincide with the Dubai Shopping Festival dates.

Party with a scenic view

Enjoy an evening out in Dubai with your friends and loved ones. We recommend an evening at Shimmers , one of Dubai’s famous places for a special meal. This beachside restaurant in Palm Jumeirah is known for its beautiful location and enchanting views of the Burj Al Arab. Enjoy authentic Greek cuisine in a casual yet intimate atmosphere. This is an ideal inclusion in a Dubai honeymoon package. You can also head to the Lounge at the Armani Hotel for an aperitif or nightcap in quiet luxury, enjoying an unforgettable view of the Dubai Fountain.

Jumeirah Beach Walk

Jumeirah Beach is very upscale and pleasant part of Dubai. The Walk at Jumeirah Beach is a popular open-air hangout full of fashion boutiques, retail stores, cafes and restaurants. Visitors can enjoy the incredible views of the water and the pleasant sea breeze, shop for unique handicrafts and designer products, and enjoy the buzzing vibe of this extremely chic walkway. This place is also where you are likely to see some of the best cars in the world! It is especially popular at night.

Here’s one for the adrenalin junkies. Skydiving in Dubai promises an opportunity to experience freefall right over the unique Palm Jumeirah landscape, or if you prefer it, over the desert outside the city. Experienced instructors guide you every step of the way, so that even beginners can try their first skydive in Dubai. Both tandem and solo skydives are available. It is a heavenly experience worth every second. A child-friendly setting to get a sense of skydiving is available at iFly Dubai , a 10m acrylic glass tunnel for an indoor skydiving simulation experience at Mirdif City Centre.

The 5 most Instagram-worthy luxury experiences in Dubai

Dubai’s high-flying lifestyle is tempting in many ways, with top-of-the-world experiences to explore. Splash out on these unique things to do in Dubai: 

Gyrocopter Ride:   If you wish to take a bird’s eye view of Dubai’s glittering skyline and cityscape, try the gyrocopter experience. This is a small private aircraft, rather like a helicopter, that seats two people and operates from the Dubai Marina. Along with your pilot, you will fly over the Dubai Marina, the Palm Jumeirah, and past the Burj Al Arab. Enjoy the smooth 20 minute ride, with views of the brilliant blue ocean and the glittering skyscrapers of the city. Truly an experience for the ‘gram!

Stretch Limousine Ride:  Feel on top of the world with a luxury ride around Dubai in a gorgeous Stretch Limousine with your own private chauffeur. The one hour drive around Dubai will take you past the city’s highlights like the Burj Al Arab, the Burj Khalifa and the upscale Mall of the Emirates. Enjoy riding around in your luxury vehicle and catching the eye of everybody you pass, as you sit back and relax in your comfy leather seats. This is the perfect insta-worthy experience to book on your Dubai trip if you wish to impress someone special or even plan a proposal!

Chopper Ride:  Make your Dubai trip a memorable one by adding a Helicopter Tour to your Dubai sightseeing. You will take off from the Jumeirah Heliport and fly past iconic sights such as the Burj Khalifa and various other Dubai skyscrapers. Depending on the duration of the flight you have chosen, you will also be able to see sights like the Palm Jumeirah, the Jumeirah coastline, Dubai Canal, Burj Al Arab, Port Rashid, etc. A Helicopter tour of Dubai is certainly a premium add-on to your luxury Dubai holiday.

Private Yacht Ride:  If you prefer being on the water than in the air, we recommend hiring a luxury yacht for a private tour of 2 hours duration. The yacht can take a maximum of 6 persons, so it is great for a family or small group. Enjoy zipping around in your private yacht, relaxing in comfort and watching the skyline as you sip on water and soft drinks. Enjoy the different view of famous places in Dubai like the Atlantis Palm hotel and the Burj Al Arab from the water.

Full-Day Musandam Dibba Tour:  Musandam in Oman is also called the “Norway of Arabia” due to its stunning coastline. This spectacular region, with its beautiful Arabian Sea coast and spectacular Hajar mountain ranges, is just a two-hour drive away from Dubai but offers a complete contrast from Dubai’s modern urban cityscape. Drive to Musandam Dibba and board a traditional Dhow for a cruise on the sparkling waters. You can choose to just relax and enjoy the views, or go swimming and snorkelling in the clear water. The tour to Musandam Dibba can be a highlight of your Dubai package, but remember to prebook it, since it must be blocked in advance along with passport details. You can add this to your Dubai honeymoon package as well.

The list of things to do in Dubai is endless, and very soon you will realise that a single Dubai trip is not enough to fully explore this city of gold. Luckily, the Dubai ticket price for a flight from India is quite attractive especially if booked together with a package, so multiple Dubai holidays are a definite option! We do hope that this Dubai guide will help you pick your favourite places to visit in Dubai for your first Dubai trip. MakeMyTrip has a varied range of Dubai packages from Delhi, Mumbai, and all other major airports of India. So go ahead and start shortlisting those Dubai packages!

A vacation in the glittering city of Dubai will surely leave you spellbound, whether it’s a family holiday, a honeymoon trip, or a tour with friends. Dubai astonishes you with some of the biggest constructions in the world. State-of-the-art skyscrapers, luxurious shopping hubs, bustling nightlife, extravagant activities- the city has many ways to keep you entertained during your Dubai holidays . Take advantage of the extensive and customisable Dubai package from MakeMyTrip and plan your holiday as per your preference. Take your trip to next level and experience the luxurious lifestyle of Dubai with add-on activities in your Dubai package like a private yacht ride, a stretch limousine ride with a private chauffeur or a gyrocopter ride. Add a chopper ride to your sightseeing itinerary and make your vacation memorable. Book a Dubai package and witness the man-made marvel, world’s tallest building - the Burj Khalifa. Visit Dubai Aquarium, the world’s largest suspended aquarium, and treat yourself to a walk amidst an array of aquatic life. Have a shopping experience to remember in the world’s second largest shopping mall, the Dubai Mall. Experience that adrenaline rush with sky-diving in your Dubai package . Experience a gastronomic delight during your Dubai holidays with a variety of delicacies, satisfying the taste buds of both vegetarians and non-vegetarians. Your Dubai trip would not just be a vacation, but a lifetime experience of an ultramodern life and a peek into the future. So, wait no more and book your Dubai package now!

Best Sellers at Epic Discounts

Customizable  +  VISA

Breathtaking Dubai Break Package

2 Transfers

Spellbinding Dubai Package

2 Activities

  • Desert Safari

Group Package  +  VISA

Dazzling Group Departure with 2 N...

7 Activities

  • Dhow Cruise
  • Dubai city tour

Limitless with Dubai Package

Dubai super saver - 5 star package, feel the magic of love in dubai....

  • Full Day Experience

Dubai Super Saver - 3 Star Package

  • Half Day Sightseeing Tour

Let Love Take Over

Tag along with your soulmate for a romantic vacay to Dubai with our special packages.

Wonderful Dubai Getaway Package

  • Full Day Sightseeing Tour

Floating Hotel Special Couples Re...

3 Activities

  • Dubai Combo

Blissful Blend of Mauritius & Dub...

4 Transfers

Let love surround you on your vacation to Dubai. Adore the sparkle of the city at night,...

All Things Fine & Lavish in Dubai...

Experience romantic escape with your loved ones

Lavish Dubai with Palm Jumeirah -...

Dubai ultimate all-inclusive.

The package includes everything one might need or desire, leaving nothing essential or desired behind.

Dubai Beyond Usual Package

  • Dubai Dolphinarium

Wonderful Dubai Holiday Package

1 night atlantis the palm dubai h..., a magical week in dubai package.

4 Activities

Ultimate Atlantis Escape Package...

Frequently asked questions about dubai.

Ans. If you want your Dubai travel plans to be hassle-free, you must also apply for its visa beforehand. A 30-day Dubai visa costs around AED 330 per person which is approximately ₹ 7,350. On the other hand, a 90-day visa would cost nearly AED 650 per person i.e., ₹ 14,500. Passport with a validity of at least six months with 2 minimum blank pages is also mandatory to visit Dubai from India.

Ans. You can cover all the main attractions of Dubai in 5 days. Here is a suggested plan for your Dubai trip in 5 days, giving a good mix of leisure and sightseeing: 

Day 1: Arrive in Dubai by flight; relax and go for a Dhow Cruise with Dinner in the evening. 

Day 2: Morning city tour of Dubai and shopping at Dragon Mart; evening Desert safari with BBQ dinner. 

Day 3: Visit the Burj Khalifa’s 124th Floor, followed by the Dubai Aquarium and Underwater Zoo. 

Day 4: Tour of Ferrari World and Abu Dhabi. 

Day 5: Morning shopping and leave for the airport!

Ans. Most people prefer Dubai travel packages in the months between November and February. It is the best time in terms of the weather, with pleasant temperatures and a vast line-up of special events and festivals. The months from June to August are usually considered the off-season in Dubai for tourists due to an extremely hot weather.

Ans. Booking a Dubai travel package and not trying the local food is a strict no-no! You should feast on the local delicacies that are loved by travellers from across the world. While the Emirate is home to the world’s best-known restaurants and cafes, along with offering cuisines from several parts of the globe, there are still a few quintessentially authentic and local delights that you should not miss. Some of them include the following: Luqaimat- You will love digging into these hot and tasty dumplings which taste just the same as piping doughnuts. Dubai has several cafes whipping up fresh Luqaimat for visitors, accompanied with delectable coffee. Knafeh- It is a Palestinian dessert that uses dough, sour cheese and sugar syrup. It is also a popular Iftar item during the holy month of Ramadan. Camel Dishes- Camel meat is served by multiple restaurants in the city, combined with Biryani, stews, sliders, burgers and a lot more. Camel milk is also worth trying in the form of sumptuous ice cream in flavours such as date, chocolate and pistachio. Samboosa-It is a marvellous snack that will fill you up with its vegetables and meat, accompanied by a generous sprinkling of spices. Some of these pastries even come with cheese stuffing. Chebab- Try an authentic breakfast item named Chebab and you’ll be delighted! These are pancakes stuffed with date syrup and sour cheese, while being heated impeccably to exude an unmatched flavour. Needless to say, you’ll not regret the experience one bit.

DUBAI PACKAGES BY THEME

  • Dubai Culture Packages
  • Dubai Adventure Packages
  • Dubai Wildlife Packages
  • Dubai Offbeat Packages
  • Dubai Pilgrimage Packages
  • Dubai Honeymoon Packages
  • Dubai Family Packages

POPULAR THEMES IN INDIA AT MAKEMYTRIP

  • Culture Packages
  • Adventure Packages
  • Honeymoon Packages
  • Pilgrimage Packages
  • Wildlife Packages
  • Offbeat Packages
  • Wellness Packages

TOP DOMESTIC AIRLINES

  • IndiGo Airlines
  • Jet Airways
  • SpiceJet Airlines
  • Air India Express

Best Selling International Tour Packages

  • Bali Tour Packages 
  • Maldives Package
  • Thailand Tour Packages
  • Europe Tour Packages
  • Singapore Tour Packages
  • Bangkok Tour Packages
  • Sri Lanka Tour Packages
  • Malaysia Tour Packages
  • Switzerland Tour Packages
  • London Tour Packages
  • Mauritius Tour Packages
  • Australia Tour Packages
  • Hong Kong Tour Packages
  • Pattaya Tour Packages
  • Paris Tour Packages
  • Phuket Tour Packages
  • Greece Tour Packages
  • Vietnam Tour Packages
  • Indonesia Tour Packages
  • New Zealand Tour Packages
  • South Africa Tour Packages
  • Bhutan Tour Packages
  • Nepal Tour Packages
  • Egypt Tour Packages
  • International Tour Packages
  • Dubai Expo Packages
  • Turkey Tour Packages
  • Kenya Tour Packages

Best Selling India Tour Packages

  • Manali Tour Packages
  • Andaman Tour Packages
  • Goa Tour Packages
  • Kerala Tour Packages
  • Ladakh Tour Packages
  • Ooty Tour Packages
  • Rajasthan Tour Packages
  • Kashmir Tour Packages
  • Darjeeling Tour Packages
  • Coorg Tour Packages
  • Gangtok Tour Packages
  • Sikkim Tour Packages
  • Himachal Tour Packages
  • North East Tour Packages
  • South India Tour Packages
  • Bhubaneshwar Tour Packages
  • Nainital Tour Packages
  • Mahabaleshwar Tour Packages
  • Shillong Tour Packages
  • North India Tour Packages
  • Agra Tour Packages
  • Shirdi Tour Packages
  • Mussoorie Tour Packages
  • Shimla Tour Packages
  • Uttarakhand Tour Packages
  • Munnar Tour Packages
  • Jaisalmer Tour Packages
  • Delhi Tour Packages
  • Bangalore Tour Packages
  • Hyderabad Tour Packages
  • Udaipur Tour Packages
  • Gujarat Tour Packages
  • Chennai Tour Packages
  • Mumbai Tour Packages
  • Holiday Packages
  • Cordelia Cruise Packages
  • Kullu Tour Packages
  • Rann Utsav Packages
  • Andaman And Nicobar Tour
  • Kullu Manali Packages
  • Shimla Manali Package
  • Delhi Agra Tour Package
  • Mathura Vrindavan Tour Package
  • Leh Ladakh Packages
  • Jammu Kashmir Tour Package
  • Darjeeling Gangtok Tour Packages
  • Chardham Yatra Package

Best Selling Dubai Packages From India

  • Dubai Packages From New Delhi
  • Dubai Packages From Mumbai
  • Dubai Packages From Bangalore
  • Dubai Packages From Hyderabad
  • Dubai Packages From Ahmedabad
  • Dubai Packages From Kolkata
  • Dubai Packages From Chennai
  • Dubai Packages From Chandigarh
  • Dubai Packages From Lucknow
  • Dubai Packages From Pune
  • Dubai Packages From Indore
  • Dubai Packages From Jaipur
  • Dubai Packages From Nagpur
  • Dubai Packages From Kerala
  • Dubai Packages From Patna
  • Dubai Packages From Raipur
  • Dubai Packages From Bhubaneswar
  • Dubai Packages From Varanasi
  • Dubai Packages From Surat
  • Dubai Packages From Amritsar
  • Dubai Packages From Goa
  • Dubai Packages From Vishakhapatnam
  • Dubai Packages From Ranchi
  • Dubai Packages From Guwahati
  • Dubai Packages From Bhopal
  • Dubai Packages From Srinagar
  • Dubai Packages From Jammu
  • Dubai Packages From Vadodara
  • Dubai Packages From Vijayawada
  • Dubai Packages From Coimbatore

Best Selling Honeymoon Packages in India

  • Manali Honeymoon Packages
  • Goa Honeymoon Packages
  • Kerala Honeymoon Packages
  • Andaman Honeymoon Packages
  • Ooty Honeymoon Packages
  • Shimla Honeymoon Packages
  • Darjeeling Honeymoon Packages
  • Munnar Honeymoon Packages
  • Kashmir Honeymoon Packages
  • Kodaikanal Honeymoon Packages
  • Coorg Honeymoon Packages
  • Sikkim Honeymoon Packages
  • Nainital Honeymoon Packages
  • Gangtok Honeymoon Packages
  • Chennai Honeymoon Packages
  • Rajasthan Honeymoon Packages
  • Mumbai Honeymoon Packages
  • North East Honeymoon Packages
  • Mussoorie Honeymoon Packages
  • Port Blair Honeymoon Packages

Best Selling International Honeymoon Packages

  • Maldives Honeymoon Packages
  • Mauritius Honeymoon Packages
  • Bali Honeymoon Packages
  • Bangkok Honeymoon Packages
  • Thailand Honeymoon Packages
  • Singapore Honeymoon Packages
  • Switzerland Honeymoon Packages
  • Europe Honeymoon Packages
  • Sri Lanka Honeymoon Packages
  • Greece Honeymoon Packages
  • Malaysia Honeymoon Packages
  • Phuket Honeymoon Packages
  • New Zealand Honeymoon Packages
  • Paris Honeymoon Packages
  • Seychelles Honeymoon Packages
  • Australia Honeymoon Packages
  • Italy Honeymoon Packages
  • Santorini Honeymoon Packages
  • Nepal Honeymoon Packages
  • International Honeymoon Packages

Best Selling Domestic Tourism Packages

  • Manali Tourism
  • Andaman Tourism
  • Goa Tourism
  • Kerala Tourism
  • Ladakh Tourism
  • Ooty Tourism
  • Rajasthan Tourism
  • Kashmir Tourism
  • Darjeeling Tourism
  • Coorg Tourism
  • Gangtok Tourism
  • Sikkim Tourism
  • Himachal Pradesh Tourism
  • North East Tourism
  • South India Tourism
  • Bhubaneshwar Tourism
  • Nainital Tourism
  • Mahabaleshwar Tourism
  • Gujarat Tourism
  • North India Tourism
  • Agra Tourism
  • Shirdi Tourism
  • Mussoorie Tourism
  • Shimla Tourism

Best Selling International Tourism Packages

  • Bali Tourism
  • America Tourism
  • Maldives Tourism
  • Dubai Tourism
  • Thailand Tourism
  • Europe Tourism
  • Singapore Tourism
  • Bangkok Tourism
  • Sri Lanka Tourism
  • Malaysia Tourism
  • Switzerland Tourism
  • London Tourism
  • Mauritius Tourism
  • Australia Tourism
  • Hong Kong Tourism
  • Pattaya Tourism
  • Paris Tourism
  • Phuket Tourism
  • Greece Tourism
  • Vietnam Tourism
  • Indonesia Tourism
  • New Zealand Tourism
  • South Africa Tourism
  • Bhutan Tourism
  • Nepal Tourism

Best Selling Night Packages

  • Goa Packages for 3 days
  • Thailand Packages for 7 days
  • Maldives Packages for 3 days
  • Goa Packages for 4 days
  • Maldives Packages for 7 days
  • Bali Packages for 4 days
  • Thailand Packages for 3 days
  • Maharashtra Packages for 3 days
  • Bali Packages for 7 days
  • Coorg Packages for 3 days
  • Dubai Packages for 7 days
  • Goa Packages for 5 days
  • Maldives Packages for 5 days
  • Manali Packages for 3 days
  • Udaipur Packages for 3 days
  • Karnataka Packages for 4 days
  • Auli Packages for 4 days
  • Dubai Packages for 5 days
  • Jaisalmer Packages for 3 days
  • Karnataka Packages for 3 days
  • Krala Packages for 4 days
  • Uttarakhand Packages for 10 days
  • Manali Packages for 4 days
  • Maldives Packages for 4 days
  • Manali Packages for 5 days

MakeMyTrip Gift Cards

  • Wedding Gifts
  • Wedding Gift Card
  • Anniversary Gifts
  • Anniversary Gift Card
  • Birthday Gifts
  • Birthday Gift Card
  • Diwali Gifts
  • Diwali Gift Card
  • Valentines Day Gifts
  • Valentines Day Gift Card
  • Farewell Gifts
  • Gifts For Men
  • Christmas Gifts
  • Gift For Boys
  • Gifts For Sister
  • Bhai Dooj Gifts
  • Gifts For Boyfriend
  • Mother's Day Gifts
  • Gifts For Couples
  • Raksha Bandhan Gifts
  • Gift For Husband
  • Gifts For Girls
  • Corporate Gifts
  • Gift For Girlfriend
  • Gifts For Friends
  • Gifts For Women
  • Gifts For Mom

Best Selling Pilgrimage Packages

  • Kedarnath Tour Package
  • Vaishno Devi Tour Package
  • Tirupati Package
  • Amarnath Yatra Package
  • Murudeshwar Tour Packages
  • Do Dham Yatra Package
  • Kanchipuram Tour Package
  • Hemkund Sahib Package
  • Guruvayur Tour Package
  • Puri Tour Package
  • Rameshwaram Tour Package
  • Haridwar Tour Package
  • Vrindavan Tour Package
  • Dwarka Tour Package
  • Mathura Tour Package
  • Varanasi Packages
  • Badrinath Tour Package
  • Somnath Tour Package
  • Ayodhya Tour Packages
  • Mahabalipuram Tour Package
  • Ujjain Packages
  • Mahakaleshwar Tour Package
  • Omkareshwar Tour Package
  • dubai Tour Packages

You are using an outdated browser. Please upgrade your browser to improve your experience.

We use cookies to improve your website experience and provide more personalized services to you, both on this website and through other media. By continuing to use this website, you agree to our use of cookies as explained in our Cookie Policy . Please read our Cookie Policy for more information on how we use cookies and how you can disable them.

care

New User? Register

  • Manage bookings
  • Cancellation
  • On Behalf Booking

We're unable to sign you in because the password entered incorrect.

Your request for OTP will be sent to registered email id and mobile number, if not registered please do the same.

You exceed the OTP limit. Please try again after some time

best dubai travel packages

Don't have an account?

  • Contains between 8-12 alphanumeric characters.
  • Can add special character but not mandatory(Only !, @, #,$,%,^,&,* to be used).
  • Does not contain White spaces

I would like to be kept informed of special Promotions and offers. I hereby accept the Privacy Policy and authorize Thomascook to contact me.

Already have an account?

  • Your existing Google or Facebook Id will be a Thomascook ID
  • No need to remember different Ids & Passwords
  • One Click login

Fill in the email Address that you used to register or book with Thomascook.

We will reset and send your new password.

Please enter the valid email address

Thomascook Staff / Preferred Agents / corporate's, please enter your Login-id only. E.g. Tcil_aalok / Jaft_prakash / Rc_mumbai

Your request for new password has been accepted.

The new password would be emailed to the registered email address, if not registered please do the same

The page you searched is temporarily unavailable

Kindly use the links below..

  • international tour packages
  • dubai tour packages

Wooden bench in a forest

Oops! We could not find any result for the given search.

Sorry, the fields marked in red need your attention, please fix them to continue.

Dubai Tour Packages - Buy 1 Get 1 Free

Holiday tour packages (trending).

dom-1

International Tour Packages

dom-1

India & Around Tour Packages

I accept Privacy Policy and I authorise Thomas Cook Group Companies to contact me.

International Tour Packages (Trending Destinations)

dom-1

Europe Tour Packages

Stroll through the beaches and explore the wild in the cultural island with your better half. Maldives is an all-in-one experience.

dom-1

USA Tour Packages

Visit USA - the third largest continent in the world. Packed to the brim with personality, charm, diversity and great natural beauty.

dom-2

Australia Tour Packages

A trip to Australia is a must if you crave for a blend of adventure, scuba diving, colorful mountains, rich wild life and much more.

dom-3

New Zealand Tour Packages

Unending vistas of breath-taking landscapes await you at New Zealand – Fall in love with huge mountains, clear waters, adventure, wildlife & more.

dom-4

Asia Tour Packages

The land of hidden gems, unexplored grasslands, temple towns, bustling streets and golden beaches; this is Asia for you.

dom-4

Mauritius Tour Packages

They say that Mauritius was fashioned out of the handbook of the Gods. For the most part, it’s true.

dom-4

Singapore Tour Packages

Bling and sparkles everywhere with tall buildings, scrumptious food, and lightning speed transport - Singapore deserves a spot on your ultimate holiday bucket list.

India Tour Packages & Around

dom-1

Andaman Tour Packages

The Andamans - A wonderland of teal and turquoise. Where the seafood is more flavourful, and the fruits are juicier.

dom-1

Kerala Tour Packages

Welcome to God's own country. Kerala is where tranquil backwaters, manicured tea estates, enchanting forests, beguiling mountains await you.

dom-2

Himachal Tour Packages

The land of Gods awaits your visit. Choose to relax & enjoy its stunning beauty with the love of your life or wish to heed your spiritual call & discover yourself.

dom-3

Rajasthan Tour Packages

Rajasthan synonym Royal, Regal, Revered. A magical universe of colour coded kingdoms. A place where little red turbans and green saris dance to classical music.

dom-4

Kashmir Tour Packages

Experience Heaven on Earth. Beautiful verdant mountains and valleys, religious shrines, temples, wildlife, art and culture, festivals and much more.

dom-4

Sri Lanka Tour Packages

A teardrop, found sliding along the Indian Ocean, is the magical land of Sri Lanka. It's is a magical, beautiful and diverse nation.

dom-4

Bhutan Tour Packages

Bhutan is a jumble of impressions. A melange of sight, sound and taste. And its a one of a kind place where happiness is measured.

Truly a global city of the future, Dubai is less of a city and more of an experience. And the experience that is Dubai, is best explored with Thomas Cook India's Dubai tour packages . They offer you a wide range of choices to plan the perfect Dubai trip and get your fill of the best it has to offer. A memorable experience is guaranteed regardless of which Dubai tour package by Thomas Cook India you choose. Thomas Cook provides Buy 1 Get 1 offer on Dubai tour packages starting at just Rs. 21 137.

Table of Content

  • Popular Dubai Tour Packages 2024

Plan your Dubai Tour with Thomas Cook

  • Best time to visit Dubai

Honeymoon in Dubai

  • How to reach Dubai
  • Best Places to Visit in Dubai

Foods to Eat in Dubai

Best restaurants in dubai.

  • Things to do in Dubai

Dubai Shopping Festival 2023-24

Shopping in dubai, adventurous things to do in dubai, best places to stay in dubai, people also ask about dubai tour packages, most popular dubai tour packages 2024.

Why Choose Dubai Tour Packages from Us

Every Dubai holiday package is a curated collection of experiences put together by the travel experts at Thomas Cook India, who are themselves, seasoned travellers, having taken a Dubai holiday many times. This means that no one else can take you on a Dubai tour like Thomas Cook India can. Furthermore, Thomas Cook India understands that no two Dubai packages are alike and everyone has different expectations from a Dubai tour package. You, therefore, have the freedom to customize a Dubai holiday that checks all your boxes of things to do in Dubai. In keeping with social distancing norms, you can even book Thomas Cook India's Dubai trip packages online.

Wherever you live in India, Dubai beckons as it enjoys direct connectivity with all the major cities of India like Mumbai, Delhi, Kolkata, Chennai, Bengaluru and Hyderabad. So, pack your bags and get ready for the ultimate desert vacation. Read on to find out more about your dream Dubai vacation. 

The Best Time to Visit Dubai

Winter, from November to April, is the best time to book your Dubai package with Thomas Cook India. Dubai has two main seasons, summer and winter. Between May and October, the summer season takes over Dubai and the temperatures average between 24°C and 43°C. On the other hand, the winter temperatures are relatively pleasant and range between 19°C to 32°C, making it the ideal season for a Dubai holiday. Winter is also the season when Dubai receives most of its rainfall. These showers will make your Dubai tour a pleasant experience without hampering your Dubai sightseeing.

The temperate winter allows you to explore Dubai’s beaches and indulge in outdoor activities such as picnics, desert safaris and dune bashing during your Dubai vacation. The days see warm sunshine and bright blue skies while the evenings are fanned by the gentle desert winds. If you’re a shopaholic looking for amazing deals during your Dubai holiday, January and February are your months to visit Dubai. The Dubai Shopping Festival starts in January and continues into February and offers incredible deals, as much as a 75% discount, on electronics, jewellery, fashion and more.

Dubai is the perfect honeymoon destination for couples looking to honeymoon in fast-paced cosmopolitan cities with tons of excitement around every corner. When you book a Dubai tour package don't forget to check out our offers for your dubai honeymoon, you book a trip to an exotic paradise that fuses its native Arabian traditions with all of the luxuries of the West. Dubai is a cultural melting pot where you can rub shoulders with people from all over the globe, not to mention enjoy a diverse medley of cuisines. Then, of course, there is the rugged beauty of the desert and the adventures you can experience during your Dubai tour, whether you plan on enjoying a day at the races or taking a desert safari to watch the exotic shimmy of a belly dancer. Thomas Cook India gives offer on Dubai trip packages to guarantee your honeymoon lasts longer than the time you actually spend in Dubai thanks to all the memories you will create together.

During your romantic Dubai holiday, there are plenty of fun-filled activities to squeeze into your Dubai tour package ranging from shopping at the massive Dubai Mall to sailing along the Dubai Creek in a dhow whilst enjoying a romantic dinner and soaring up to the observation deck at the Burj Khalifa to add a spark of adventure to your marriage. 

How to Reach Dubai

The Dubai International Airport is a world-class terminal and the busiest one in all of UAE. It is well connected to almost all the major Indian cities such as Mumbai, Delhi, Chennai, Bengaluru, Kolkata and Hyderabad making it an easy task to reach Dubai . You can easily get regular direct or connecting flights into Dubai from any of these cities. Some of the well-known airlines that operate flights to Dubai include Emirates, Etihad, FlyDubai, Air India, SpiceJet and IndiGo. Dubai’s airport sits 5 kms outside the city but is well connected with public transport.

If you cannot find a flight to Dubai, the next best option is to fly into Sharjah, which is Dubai’s closest neighbour. You will need a visa before you land in Dubai. Getting a UAE visa is easy, and you can get yours in 4-5 working days. However, if you hold a valid US, UK or Schengen visa, you do not need a separate visa for Dubai. All you must do is fill up a form after landing.

Local Transport Within Dubai

The public transportation system in Dubai - metro, buses, trams, abras, ferry, and water taxi - are managed by the RTA. The best part is that all these services use the same ticket type - the NOL card. You don't need to worry about purchasing a different ticket for each service. You could alternatively rent a car to drive yourself around provided you possess the prerequisite driver’s license.

Places to Visit in Dubai

Starting out as a tiny fishing village, the emirate of Dubai has become the pearl of the Middle East. Your Dubai holiday is set against the backdrop of one of the most sought-after holiday destinations in the world. Therefore, your list of places to visit in Dubai must be suitably updated to reflect the best of its larger-than-life, world-class entertainment, its parks and resorts, its grand malls.

Here are the best places to visit in Dubai:

The Burj Khalifa - Tallest Building in Dubai

Dubai mall - biggest mall in dubai, madinat jumeirah, the dubai fountain - magical medley of lights, water & sound, mall of emirates - luxury shopping destination in dubai.

  • Dubai Aquarium   – Unique Underwater Zoo

Beaches in Dubai

Jbr open beach, umm suqeim beach, marina beach, jebel ali beach.

Piercing the sky, the Burj Khalifa dominates Dubai’s landscape and is visible from miles around. The observation deck on the 124th floor opens to some of the most stunning vistas of Dubai and the desert around. It is said that you can watch the sunset twice in the same day at the Burj Khalifa! Take in the views as you enjoy a sundowner at the highest lounge on the planet located on the 154th floor. This is one experience in Dubai you should not miss.

To call Dubai a shopper’s paradise would be quite an understatement. The retail experience in Dubai goes beyond just shopping. Not only do you enjoy amazing discounts, but you’re also a part of an extravaganza that knows how to pamper shoppers. The Dubai Mall , right next to the Burj Khalifa, is the best example of shopping indulgence. You will be spoilt for choice with more than 1,200 shops and 150 restaurants. It also houses an indoor theme park, the Dubai Aquarium and Underwater Zoo, an ice-skating rink and a majestic indoor waterfall. With so much to explore, you can easily spend one whole day at the Dubai Mall.

If any place in Dubai is the seamless blend of the past and the present, it must be the Madinat Jumeirah. Its name translates as ‘ City of Jumeirah ’. This beautiful resort complex by the sea takes its design inspirations from the traditional strongholds of Dubai. It encloses a multitude of private enclaves and luxury hotels built in the traditional style but equipped with all the modern amenities. The best way to explore this luxurious complex is on a traditional wooden arba that takes you around at a leisurely pace. 

A captivating water, music and light spectacle in Downtown Dubai, The Dubai Fountain is the world’s tallest performing fountain. At over 900 ft in length – equivalent to over two football pitches – The Dubai Fountain is situated on the 30-acre Burj Lake and performs to a selection of different melodies. The fountain has a unique design comprising five circles of varying sizes and two arcs and features powerful water nozzles that shoot water up to impressive heights. When operational, the fountain has over 22,000 gallons of water in the air at any given moment.

The mall of the Emirates in Dubai is a must visit place on any Dubai tour . It offers multiple entertainment activities to tourists under one roof and is one of the largest malls in the world and has over 630 brands under one roof covering an area of 233,467 sqm. With many fascinating activities in one place such as Magic Planet, VOX Cinemas, Theatre of Rhodes, and the jaw-dropping Ski Dubai, visiting this mall during your Dubai holiday will never disappoint you. 

Dubai Aquarium – Unique Underwater Zoo

Dubai Aquarium & Underwater Zoo is home to thousands of aquatic animals, comprising over 140 species. Over 400 Sharks and Rays live in our 10 million litre tank, including Sand Tiger Sharks, Giant Groupers, and a host of other marine species. A series of animal encounters and diving experiences allows visitors to come face-to-face with the aquatic residents. From Small-clawed Asian Otters to Sharks and Rays, there are plenty of memorable moments to be had with your friends and family at Dubai Aquarium & Underwater Zoo during your Dubai holiday.

Dubai is well known as a luxury travel destination, but it is also home to miles and miles of pristine beaches with soft white sands and clear water. These beaches are located on the temperate, aquamarine-blue Persian Gulf that is known for its calm seas and beautiful weather. Make it a point to visit these 5 beaches in Dubai during your Dubai trip. 

The biggest beach in Dubai, the massive JBR Open Beach has fluffy white sand and warm, beautiful turquoise waters. Here you can rent jet skis to zip across the waves and scooters to zip across the promenade that lines this beach. Make sure to check it our on your nest Dubai package.

For Insta-worthy pics of the sea with the Burj al Arab in the background, head to Umm Suqeim Beach. Also known as Sunset Beach this wide, flat beach is where the Burj is located. This beach is also one of the few surfing spots in Dubai. A must visit beach on your trip to Dubai.

Kite Beach is very popular with Dubai's foodies as many food trucks assemble here during the day and evening. Also, many little restaurants and cafés line Jumeirah Beach Road, which runs along this beach.

For a luxurious beach experience, head to Marina beach. The Dubai Marina is a luxury residential area and Marina Beach is a section of sandy beach that runs parallel to it. It is a wide, beautiful beach with soft white sand. At Marina beach you're also close to Restaurants, shops, little cafés, and ice-cream shops that line the promenade. Your Dubai holiday is incompletes without a trip to this luxury beach.

Jebel Ali is about 30 minutes south of downtown Dubai and the emirate's newest recreational zone. Home to the world's largest man-made harbour, the area is home to many long, sandy beaches where you can find yourself virtually alone. Besides typical beach activities and water sports, Jebel Ali is a popular dive area. 

From hearty and flavourful street food to decadent Michelin-starred creations, you can get it all in Dubai. The flavours of the city will infuse your heart with their sheer variety. Here are our picks of food that you should taste in Dubai.

Stuffed Camel

This dish is a culinary delight that takes hours to make, with ingredients that are remarkably simple. This dish is a must try on your Dubai package. Nothing but salt is added to a pot of wheat and lamb or camel meat, and these are cooked until the texture is smooth and uniform. The resulting mixture slowly baked overnight. The result is nothing short of alchemy. In a land famed for the spice trade, Al Harees is a remarkably simple dish that will Bring delight to your palate during your Dubai trip.

This refreshing pudding is a hit with the kids. Be sure to try some during Your Trip to Dubai with your family. Mehalabiya’s is decadently flavoured with rosewater and pistachios and tastes like a cool, calm desert breeze. It is perfect for those who seek an after-dinner treat that isn’t too sweet. You cannot miss out on this luscious dessert on your Dubai holiday package.

Also called khuzi, this dish consists of a whole-roasted lamb or goat served on kebab skewers with vegetables and hazelnuts over a bed of pilaf or fragrant rice. It is easily one of the most popular dishes in Dubai because it is considered a whole meal in itself. It’s also happens to be the national dish of the United Arab Emirates, which means any Dubai trip without ghuzi is an incomplete one.

Named by the Guinness World Book of Records as the largest foods you can eat, a stuffed camel is one of the most opulent meals you can sit down to on your Dubai holiday.

Cooked on a spit and stuffed with chicken, eggs, fish and even whole sheep stuffed camel is considered a traditional food in Dubai, served at weddings and Bedouin feasts. This meal could very well be the highlight of your Dubai trip. You know, you need to try this on your Dubai holidays!

The best restaurants in Dubai you can eat at during your Dubai holiday are:

  • La Petit Maison, Dubai - French/Italian
  • Zeng He, Dubai - Modern Chinese
  • Zuma Dubai - Japanese

For Indian cuisine on your next trip to Dubai you could visit:

  • India by Vineet
  • Carnival by Tresind
  • Basanti & Co.

Things to Do in Dubai

Dubai is one of those holiday destinations that does not let you sit still. Between its malls, theme parks and beaches, there are a range of activities that will keep you busy on your Dubai holiday. While most of the activities can be done without venturing outside, there are those that cannot be contained indoors. Here are our recommendations of things to do in Dubai.

Visit Ferrari World

Make a splash at wild wadi, ride a hot air balloon, realize your bollywood dreams in dubai, witness a miracle in the desert, frame your dubai holiday, soar over dubai with a zip line.

Get fast and furious at this amusement park in Abu Dhabi. The first Ferrari branded theme park ever built it houses the Ferrari Karting Academy, The Ferrari Store, The Junior Grand Prix, The Mamma Rossella, the turbo Track, The Formula Rossa, The Flying Aces, and much more, Ferrari World has its own adventure to offer. The excitement and thrill you will experience on your Dubai packages with offers.

From the highest loop on the planet to the fastest rollercoaster in the world, twist and turn yourself upside down on these fantastic rides designed to let you have a thrilling experience. If you are thrilled by speed, this is going to be the highlight of your Dubai holiday. 

Wild Wadi Water Park in Dubai is world famous and features amongst the best outdoor water parks in West Asia. It also holds the distinction of having housed the largest water slide outside of North America. Taking a day trip to experience the rides, slides and many swimming pools is one of the best things to do in Dubai and guarantees to make your Dubai tour a whole lot cooler.

Soar over the mesmerising Dubai desert away and take a peaceful and relaxing ride in a hot air balloon while you can marvel at the stark landscape. 

Take in the hypnotic desert vistas as you soar over the dunes and the occasional oasis on your Dubai package and make it a complete trips. Each basket holds a maximum of 24 people and there’s plenty of room for you and your family. Don't miss this wish to take a break from the fast paced city during your Dubai tour.

Bollywood Parks, Dubai is a larger than life interactive Bollywood theme park that brings alive the magic of Indian cinema and its popular characters while you hunt down Gabbar Singh with a 3D laser. Attend grand musical performances at the magnificent Rajmahal, and soar above the sky in the 4D theatre with ‘Krrish’ as all your Bollywood dreams become a reality.

Don’t miss the Bollywood Boulevard for some chaat and kulfis if you get homesick during your Dubai holiday. A true Bollywood fanatic would not miss this on his Dubai tour.

Dubai always finds ways to enchant you with its stunning architecture and splendid attractions. However, this whopping 72,000-sqm garden blooms with over 150 million flowers based installations takes the cake. The Miracle Garden hosts an award-winning life-size Airbus 380 made up of 500,000 flowers. It also has floral heart passages you can walk through and an 18-meter high Mickey Mouse for a grand photo op. This is one Dubai attraction that will turn your Dubai holiday into a journey for your soul.

Known amongst one of the tallest buildings in the world, Dubai Frame is quite literally a picture frame that has been visited by millions. Situated at a height of 150 metres, it offers beautiful views of the magnificent old and new Dubai, the glimmering water of the Gulf, and shimmer of the sands. A view that must be included on your Dubai tour.

Walking on the spectacular glass bridge, that connects the towers of the frame, gives the feeling of walking on air and is quite a thrilling experience and is one of the most unique things you can do during your Dubai holiday.

Get the best view in all of Dubai with the XLine at Dubai Marina, provided you stop screaming and keep your eyes open. This zipline is the world’s longest urban zipline that lets you see the Dubai Marina beachfront, snazzy high rises, and the vast expanses of the city cruising at a speed of 80 kmph.

You can experience this rush during your solo Dubai tour or in tandem i.e. along with a partner strapped to you.

The 29th edition of the Dubai Shopping Festival is all set to host visitors from across the globe for a shopping extravaganza! Set to begin on 8th December 2023, the Dubai Shopping Festival 2023 will offer spectacular offers until 14th January 2024.

Dubai exudes a different aura and energy during the shopping festival. It is more than just a shopping festival, it is an experience that stays with you for many years. The unique combination of cosmopolitan culture, magnificent skyscrapers, beautiful beaches, extravagant malls, and people from around the world, make Dubai during the shopping festival one of the best destinations in the world.

When it comes to shopping in Dubai, you will be spoilt for options. No surprise then that it is known as a shopper's paradise. Home to the world's largest shopping mall, The Dubai Mall, Dubai is not only about glamour and grandeur. Beneath the modern facade of the city lies an old-world charm of traditional souks where you can find everything from personalized perfumes to gold.

We have made a list of the must-buy things in Dubai so that you can shop without worry!

  • Gold Jewellery - The list of shopping in Dubai won't be complete without it, as Dubai is known as the 'City of Gold'. You can pick pretty gold pieces at a lower price compared to other parts of the globe. 
  • Arabic Attars and Oudh - Both Attars and Oudhs are renowned for their aromatic fragrance and are used widely by Arab men and women. Traditional Oudh has a very distinct smell and is slightly expensive, whereas Attars can be customized by blending scents of your choice.
  • Arabic Coffee and Kava Pots - Arabic coffee is pure coffee with a slightly bitter but refreshing taste. If you love coffee, this is one of the best things you can buy in Dubai. The pots are generally made of copper, and these can be used daily or as decorative pieces.
  • Arabian Dates - You will find a wide assortment of dates in Dubai. Taste and pick up the ones you like the most. Majdool, Shokari and Ajwa are very popular and tasty.  
  • Pashmina Shawls - Made from real goats' hair and silk, the price tag is a little heavy on the pocket. You can always choose the viscose or silk versions for an alternative if you are on a budget. 
  • Persian Rugs - Persian rugs are known for their intricate designs and detailing. The pricing depends on the size, detailing and quality of the rugs. You can also find affordable options in the souk.
  • Spices - These are extremely flavourful and are sold at affordable prices in local markets. This is the best way to bring home some authentic Middle Eastern flavours.
  • Hookah Pipes - Even though you can find them everywhere, nothing beats the authentic Arab ones. There is a wide range of options to choose from, so be spoiled for choice till you find the perfect piece.
  • Arabic Lanterns and Lamps - They are known for their beautiful filigree work and intricate patterns. These lamps are made of glass and often ornamented with beautiful stonework.
  • Sweets - There are multiple options to choose from - Baklava, Maamoul and Knafeh, to name a few. These are a must-try when in Dubai.
  • Camel Milk Chocolate - This is one of the most delicious things you can bring back from Dubai. Initially only found in Dubai, now it is exported to other countries.  

Did you know that Dubai offers its fair share of thrills as well? There are multiple adventurous things to do in Dubai that you must experience while you are there. We offers to Dubai trip to enjoy adventurous activities in Dubai. Here are few Adventurous things to do in Dubai.  

  • Dune Bashing - This is one of the most popular adventure activities in Dubai and also in demand with families as the minimum age limit is 3 years. You can get into an SUV or a Hummer and get driven around at high speeds while bashing the sand dunes. You can also combine this with a desert safari.
  • Sand boarding - It is similar to skiing but in a desert. It is fun to slide down through the sandy dunes of Dubai. It holds one of the top spots in Dubai adventure places. Minimum age limit is 13 years. 
  • Skydiving - Your Dubai trip is incomplete without watching The Palm Islands. What better to watch it than from an altitude of 14,000 feet above sea level. You will have an instructor with you throughout, so feel the adrenaline rushing while you fall at speeds of 200 kmph. Minimum age limit is 18 years. 
  • Shark Diving - Fascinated by sharks? Dubai Mall allows you to dive in with the sharks. This mall has a huge aquarium where shark diving takes place, and it's an entirely safe experience to participate in. Minimum age limit is 10 years.
  • Zip lining - With the world's longest zip-lining track, it is one of the extreme Dubai adventure places. Located at the height of 1800 feet, you get a panoramic view of the city while cruising at speeds of 60-70kmph. Minimum age limit is 10 years.  
  • Flyboarding - It is one of the unique and thrilling experiences in Dubai. Imagine flying over the water on a saddle attached to a water propulsion device. You can enjoy the landscape of Dubai while cruising at speeds of 40 kmph. 
  • Wakeboarding - This involves getting on a wakeboard and gliding through the water. The initial lift requires skills but is easily manageable once you are outside the water. Just maintain a straight posture and lean back while you are on it.   

There are many other activities that you can try in Dubai, such as deep-sea fishing, hot air balloon and Dubai helicopter tour, to name a few. There is something for everyone here! 

Dubai is a well-known luxury travel destination. With so many resorts in Dubai, there are countless options to choose from. There are multiple luxury hotel brands available, so choosing the best hotel in Dubai for your stay can be a task. We've made a list of the best hotels in Dubai to choose from, so you don't have to wonder about where to stay in Dubai. Our offers on Dubai packages offering the best hotels, sightseeing and other activities.

  • Atlantis, The Palm - Nothing defines luxury the way Atlantis does, with signature underwater suites having glass walls. It is located on the top outer edge of the Palm Jumeirah, facing the Persian Gulf. Atlantis also has other attractions such as The Lost Chambers Aquarium, Dolphin Bay, and Aquaventure waterpark.   
  • Four Seasons Resort Dubai at Jumeirah Beach - Located on the shore of the Arabian Gulf, this resort provides the ultimate five-star experience. From beautiful sea-facing rooms and suites to a host of amenities, you can stay in luxury while indulging yourself in multiple activities.  
  • Burj Al Arab, Jumeirah - The only seven-star hotel in the world, this luxury resort has its peninsula near the Jumeirah beach. It has 201 duplex apartment suites that come with their private butlers. With multiple cuisines to choose from, this resort has nine restaurants run by the hotel's Michelin-starred culinary team. When you leave the hotel, you can either drive or be driven in a supercar! 
  • Bulgari Resort Dubai - This resort in Jumeirah Bay Island belongs to the famous Italian jeweller. This embodies luxury, with only 101 rooms and 20 suites. They have their yacht club and marina.    
  • DoubleTree by Hilton Hotels Dubai - Situated right at the end of JBR's The Walk shopping street, this high-rise resort has no regular rooms. They are all fully-furnished one, two or three-bedroom apartments with a kitchen and patio, making this one of the best hotels in Dubai for families. They have their own private beach, and the resort is very close to the metro station, which also makes it easy to explore the various tourist attractions. 
  • Sheraton Jumeirah Beach Resort - This mid-range beach resort is located very close to Hilton along JBR's The Walk. They have a large beachfront area and also a huge garden. There are five on-site restaurants to choose from which serve a variety of cuisines such as Chinese, Italian and Middle Eastern. You can also enjoy your meal at the poolside/beachside cafe. 

Refine Search:

Must Include Places

Departure City

Price Per Person

Approx price per person

Month of Travel

Package Type

  • ( 1 ? 'N':'N' --> ) →
  • Optional Flights

Sightseeing

Tour manager, 0 --> rs. 0 --> rs. 0 --> rs. rs. 0) --> % off.

Starting price per adult

Final EMI value will be displayed post the total package cost is calculated

best dubai travel packages

Above points are approximate & calculated for Silver tier members, actual points will be credited basis your membership, after your travel is completed.

  • Silver Member - 1%*Total value ( Net )
  • Gold Member - 1.5%*Total value ( Net )

For more information, click here

Round trip Flights included

  flight optional.

  • 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' --> 1 night

TC Tour Icons

How much does a Dubai tour package cost?

Dubai ranks among the top-visited destinations in the world. There are more than 35 Dubai tour packages available at Thomas Cook India. There are packages that can be customized as per the user’s requirements. Also Thomascook have  offers on selected dubai tour packages.

What is the best time to plan a Dubai tour?

People love traveling to Dubai all around the year. If you are still looking for the best time for a Dubai tour to enjoy the artificial beaches, outdoor activities, exciting events, and live entertainment. If you like summers, June to August is the best time. Whereas if you want a pleasant climate November to March is recommended for a Dubai trip as The winter season starts to fly.

Which are some of the most visited places on a Dubai trip?

There is an endless list of famous places in Dubai and a plethora of things to do on a Dubai trip. Dubai really has it all, with everything from larger-than-life theme parks to impressive shopping malls. In recent years, Dubai has emerged as one of the most urbane and trendy destinations in the world. In fact, you will either need a month-long vacation or several shorter trips to explore the entire Dubai. Few famous attractions include B urj Khalifa at the top, Legoland, Dubai Aquarium, IMG world of adventure, etc.

What is the most convenient mode of transportation in Dubai?

A very simple answer to that is ‘ Dubai metro ’. The Dubai metro is one of the world's most advanced metro systems and is the most convenient mode of transportation in Dubai. There are also many other modes of transportation which one can choose once in Dubai are taxis, buses, the monorail, and water taxis. To book a cab in Dubai, call a taxi or use Uber or Careem, which are both app-based cab services. If you want to go exploring, you could also rent a taxi.

Will I get a visa on arrival in Dubai?

As an Indian passport holder, you can get a visa on arrival in Dubai for a maximum of 14 days provided you meet the requirements. Simply disembark from your flight at Dubai International Airport and proceed to immigration, where a free 30-day visit visa will be stamped on your passport, and enjoy your Dubai tour.

How long is the flight from Dubai to Mumbai?

The flying time for your Dubai trip from Mumbai is 3hrs 10mins to 3hrs 35mins . The distance from Mumbai to Dubai is approx. 1920 kilometers .

Do female travelers need a hijab in Dubai?

No, ladies traveling to Dubai need not wear a hijab while sightseeing or moving around the city. There no such dress code. However, ladies should cover their heads and shoulders while visiting mosques and certain public places on their Dubai trip.

Can I use my Indian driver's license in Dubai?

No! with the regular Indian driver's license you cannot DRIVE in Dubai, or anywhere else in UAE.

When is the Dubai shopping festival held?

The Dubai festival is now the world's longest-running shopping festival. It begins at the end of December every year and ends by early February. There is a number of activities such as live shows and events, raffles, performing arts, concerts, etc.

Is Dubai open on Fridays?

Fridays are known for Jummah Prayers in Dubai and hence banks, government, and private offices are shut as it is a weekly off. However, all the tourist places, malls, restaurants, shopping centers are open except few shops which shut down for an hour or so. So, if a Friday comes in your Dubai trip, it wouldn’t be a problem.

Is Dubai an expensive city?

Yes, Dubai is an expensive city, but not exorbitantly so for travelers on a holiday. Dubai ranked 58th most expensive city in the world. Yet, the city offers relatively good value for money for all their travelers.

How far is Dubai from Abu Dhabi?

The distance is approximately 170 Kilometres . You can choose the mode of transport accordingly. Buses in Dubai are very comfortable, one can also take a taxi. However, traveling by road or metro is convenient and a better option on a Dubai tour.

What are some of the activities to do in during your Dubai tour

Visiting the BurjKhalifa, go skydiving, have a lake ride at the Dubai Fountain, go on a desert safari with a BBQ meal, ride the rides at the Wild Wadi waterpark, go hot air ballooning, and more are some of the things you can do on your Dubai tour.

What currency is used in Dubai?

The currency in Dubai is the dirham .

How many days is enough to explore when on Dubai tour?

There are no fixed number days to see everything Dubai has to offer. A minimum of Three days, on the other hand, puts you in a comfortable position from which to see some of the city's top attractions.

Is it necessary to exchange money before visiting Dubai?

Yes, having cash before you arrive allows you to obtain transportation and other necessities such as food and drink more quickly and a hassle-free Dubai trip.

Is Dubai a safe place to visit for tourists?

Yes, Dubai is generally safe to visit for tourists since Dubai has a very low crime rate.

All about Dubai

Dubai packages, famous places to visit in dubai, trending india destinations, trending international destinations, dubai flights, dubai packages from city, customized dubai packages.

Click on destination labels to get refined search.

map image

  • 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' -->

Get the Best Holiday Planned by Experts!

Enter your contact details and we will plan the best holiday suiting all your requirements.

I hereby accept the Privacy Policy and I authorise Thomas Cook Group Companies to contact me.

Maximum Limit Exceeded!

You can select max 3 packages to compare

I want to holiday in

Tell us what you need? & Let your Holiday expert design package for you.

tc_chat

  • Hi, My Account Subscriptions --> My KT Trading Contact Us Privacy Notice Sign Out

Tue, Apr 09, 2024 | Ramadan 30, 1445

Dubai 20°C

  • Expo City Dubai
  • Emergencies
  • Ras Al Khaimah
  • Umm Al Quwain

Life and Living

  • Visa & Immigration in UAE
  • Banking in UAE
  • Schooling in UAE
  • Housing in UAE
  • Ramadan 2024
  • Saudi Arabia
  • Philippines
  • Cryptocurrency
  • Infrastructure
  • Currency Exchange
  • Horse Racing
  • Local Sports

Entertainment

  • Local Events

Dubai World Cup

  • Track Notes
  • Big Numbers
  • Daily Updates
  • Arts & Culture
  • Mental Health
  • Relationships
  • Staycations
  • UAE Attractions
  • Tech Reviews
  • Motoring Reviews
  • Movie Reviews
  • Book reviews
  • Restaurant Reviews
  • Young Times

Supplements

  • Back To School
  • Eid-Al-Adha
  • It’s Summer Time
  • Leading Universities
  • Higher Education
  • India Real Estate Show
  • Future Of Insurance
  • KT Desert Drive
  • New Age Finance & Accounting Summit
  • Digital Health Forum
  • Subscriptions
  • UAE Holidays
  • Year of the 50th
  • Latest News
  • Prayer Timings
  • Cinema Listings
  • Inspired Living
  • Advertise With Us
  • Privacy Notice

KT APPDOWNLOAD

Eid al fitr in uae: 20 best staycation deals across the emirates, from late check-outs to free stays, here are unmissable deals you’ve been waiting for.

best dubai travel packages

A Staff Reporter

  • Follow us on

best dubai travel packages

Top Stories

best dubai travel packages

Embracing the bright side: A guide on how to cultivate optimism

best dubai travel packages

The power of solitude: Why you should go on a solo trip

best dubai travel packages

How to get your kids to read: Essential tips for parents

best dubai travel packages

Published: Thu 4 Apr 2024, 7:10 PM

Last updated: Thu 4 Apr 2024, 7:17 PM

The much-awaited Eid Al Fitr holidays have been announced. And that means it’s time to plan a getaway.

If you are in the mood for a staycation that won’t break the bank and yet, will give you a bit of a reprieve from the daily business of life, you are in good hands.

We’ve done the research for you – here’s a look at some top deals to consider as you plan your festive break.

Stay up to date with the latest news. Follow KT on WhatsApp Channels.

Address Sky View

Always had a wish to stay in Downtown Dubai? This is your chance. The Address Sky View is offering discounts on dining and spa treatments throughout Eid. Book your room before April 7 and you are also looking at a 20 per cent discount on the best available room rates.

Various offers ongoing. Address Sky View, Downtown Dubai.

Banyan Tree

Head to the heart of Bluewaters this Eid break for a cool staycation. Check into Banyan Tree, which is offering UAE and GCC residents up to 20 per cent off on dining and spa experiences. The offer is available from April 1 until April 15, but be warned, you need to make your bookings before April 15 to capitalise on this deal.

Offer valid until Mon Apr 15. Bluewaters Island.

Lapita, Dubai Parks and Resorts, Autograph Collection

For an action-packed Eid vacation look no further than Lapita, which is close to three theme parks — LEGOLAND, RIVERLAND and MOTIONGATE — that you can spend the days enjoying. Sign up for a free Marriott Bonvoy membership for special rates on rooms that begin at Dh690.

Dubai Parks and Resorts, Sheikh Zayed Road, Dubai.

Centara Mirage Beach Resort

This one is a perfect escape for the whole family. There’s a water park on the premises as well as three kids’ clubs and a beachfront cinema that the kids will love exploring. For the grown-ups, there’s a spa.

From Dh2,000 per night throughout Eid al-Fitr. Dubai Islands.

FIVE Palm Jumeirah

If add-ons sell a place to you, FIVE Palm Jumeirah has just the right pitch. The hotel with a 150-metre private beach has a special deal that’ll see you get a four-night stay for the price of three, or an eight-night stay for the price of six.

Offer until April 5. FIVE Palm Jumeirah.

Jumeirah Emirates Towers

Looking to save on your overall staycation bill? Jumeirah Emirates Towers is one to consider. It’s offering up to a 20 per cent discount on rooms, dining and spa treatments during the upcoming break. Kids under 12 can eat and stay for free.

Various offers during Eid. Jumeirah Emirates Towers, Trade Centre 2.

FIVE Jumeirah Village

Carry your swimming trunks when you check into FIVE Jumeirah Village; you are going to need them. The resort has 269 pools and jacuzzis to choose from. And what’s more, it’s got a deal going that means you can stay for four nights for the price of three or for eight nights when you book six.

Jumeirah Creekside Hotel

Want a vacation where you can take your pooch? Head straight to Jumeirah Creekside Hotel where you can book yourself into one of its pet-friendly rooms (use the code PETCATION). If you are a UAE resident, you also get 25 per cent off on stays along with daily breakfast and late checkout (2pm) during the Eid break.

Various offers. During Eid. Jumeirah Creekside Hotel, Garhoud.

Jumeirah Beach Hotel

Get more bang for your buck when you stay at Jumeirah Beach Hotel, where you get 30 per cent off on stays and a whole lot of perks besides. The benefits include access to Wild Wadi Waterpark, Kids’ club activities and free dining for kids under 11.

Various offers during Eid. Jumeirah Beach Hotel, Umm Suqeim.

Jumeirah Zabeel Saray

If you’ve always wanted to stay in Palm Jumeriah, you can now do so at a discount. Jumeirah Zabeel Saray is offering up to 40 per cent off stays during Eid. You get unlimited access to pools (for that much-needed pool day) and a private beach (for those lovely sunset photos).

Various offers during Eid. Jumeirah Zabeel Saray, The Palm Jumeirah.

Qasr Al Sarab Desert Resort by Anantara

For a luxe stay that you’ll love, pick Qasr Al Sarab Desert Resort by Anantara. The hotel is about two-and-a-half hours away from Dubai and there are a number of desert experiences to choose from.

Offers vary. Qasr Al Sarab.

Raffles, The Palm

If you choose to stay for two nights or more at Raffles, The Palm, choose the Raffles Retreat offer, which gives GCC residents 20 percent off. Choosing this offer will give you access to one of the hotel’s rooms or suites for much less.

Deal ongoing beyond Eid al Fitr. Raffles, The Palm.

Occidental Al Jaddaf

Use the code BRESIDENT10 here for a 10 percent discount during Eid (the offer is valid for all GCC residents). The promotion is on April 11 and April 12.

GCC resident discount. Thu Apr 11 – Fri Apr 12. Occidental Al Jaddaf.

Queen Elizabeth 2

For a room with a sea view, consider ocean liner-turned hotel Queen Elizabeth 2. For its Eid offers, it’ll give you a complimentary upgrade to a sea view room, a buffet breakfast, early check-in and late check-out. You’ll also get 20 percent off on all food and drink.

Various offers. Wed Apr 10 – Sat Apr 13. Bur Dubai.

Marriott Resort Palm Jumeirah

Don’t sweat the small stuff – like bills for each thing the kids eat when you check into Marriott Resort Palm Jumeirah. The hotel is offering an all inclusive package for the kiddos that’ll give them unlimited soft drinks, snacks and treats. The young ones will also love the kids club, wading pool and activity-laden calender the hotel promises.

Dh1,200 per room per night (all inclusive package). Tue 9 Apr or Wed 10 Apr to Sat 16 Apr. Marriott Resort Palm Jumeirah.

Sir Bani Yas Island

For a lesson in history or the natural world, check out the hotels in Sir Bani Yas Island, which is a mere 25-minute boat ride from Abu Dhabi. It’s got 42 historical sites and is home to Arabian Wildlife Park, including roaming giraffes, cheetahs and gazelles.

Offers vary. Sir Bani Yas Island, Abu Dhabi.

Voco Monaco Dubai

This adult-only holiday retreat is calling on all guests to stay for Dh653 per night between April 9 and April 13. There’s a brunch on every day. It’s party time.

From Dh653. Apr 9 –Apr 13. voco Monaco, World Islands.

Jumeirah at Saadiyat Island Abu Dhabi

Abu Dhabi living on your mind? You can pick from breakfast and half board packages at Jumeirah at Saadiyat Island. In addition, you’ll also get up to 30 percent off on stays, access to a buffet breakfast and a private beach for that cool dip during the Eid break.

Various offers. During Eid. Saadiyat Island, Abu Dhabi.

The H Dubai

For a well located retreat, head to H Dubai during the Eid holidays. It’s located near the Burj Khalifa and Dubai Mall (you know, for when the need for shopping strikes). Home to the award-winning Mandara Spa, H Dubai is offering 20 percent off on stays.

Various rates, during Eid al Fitr, Sheikh Zayed Road, The H Dubai.

Vida Hotels & Resorts

You’ll want to hurry up to get this deal. This hotel chain is offering a 20 percent discount on bookings before April 7. It’s located in Marina, Emirates Hills, Creek Beach and Creek Harbour in Dubai.

20 percent off. Until Apr 7. Vida Beach Resort, Umm Al Quwain; Al Raudah, Umm Al Quwain; Vida Creek Beach; Vida Creek Harbour, Ras Al Khor; Dubai Creek Harbour; Vida Dubai Marina & Yacht Club, Dubai Marina; Vida Emirates Hills, The Hills, Dubai.

[email protected]

  • Eid Al Fitr: 10 ways to deck up your home
  • Eid Al Fitr: 5 must-try recipes for at-home celebrations
  • Eid Al Fitr 2024: 18 last-minute gift ideas for friends and family
  • [email protected]

More news from Lifestyle

'stop saying yes to being paid less': financial expert suze orman on how to make money.

Financial icon and host of the Women and Money podcast Suze Orman on how our attitudes towards money also determine our attitudes towards ourselves

lifestyle 2 weeks ago -->

Auto Review: Why the 2024 Maserati Grecale Trofeo is ready to shake up the SUV segment

Can the 2024 Maserati Grecale Trofeo bestow the Maserati magic that it once was?

lifestyle 3 weeks ago -->

My Dubai Car: Why this UAE resident decided to go electric with Tesla Model X

Why we need both yin and yang energies in entrepreneurship.

In the cut throat corporate domain, being “too feminine” has long been associated with gentleness, while on the flip side, being “too masculine” has possibly led to excessive burnout and anxiety

'UAE diversity has an impact on mental health': Sophie Trudeau

Passionate mental health advocate Sophie Gregoire Trudeau on the need to put emotional literacy at the centre of mental health conversations

Meet this 14-year-old influencer taking social media by storm

In an age when life normally is steeped in academics, Shayaan Ali is an influencer aiming to inspire people with his art and social media presence

lifestyle 1 month ago -->

Keeping it in the family: Father mentors son to uncover treasure from trash

As the need to protect the planet becomes urgent, Aliyu Mohammed Ali, CEO and co-founder of Ehfaaz aims at creating and simplifying recycling solutions within the UAE to protect and recover our resources

'Life taught me to manage money': UAE expat says leaving home at 17 made her a saver, not spender

French-Guinean expat Saran Sow Barry says saving 30 per cent of her income every month is absolutely essential

Type your keywords

IMAGES

  1. Dubai Itinerary For 5 days: A Highlights Tour Through the Best of Dubai

    best dubai travel packages

  2. 5 nights 6 days Dubai tour package

    best dubai travel packages

  3. Best tour and travel package for Dubai at Travel Recourse.

    best dubai travel packages

  4. Dubai Vacation Packages from $1,363

    best dubai travel packages

  5. DUBAI FULL TOUR VIDEO- Best Places to Visit, Dubai Travel Packages, Trip Plan- Flying Turtle

    best dubai travel packages

  6. We bring a customized vacation package for you to enjoy Dubai and

    best dubai travel packages

VIDEO

  1. 95000 Main Dubai Trip Karain l Explore Dubai With Family l Dubai Packages

  2. Top 5 Luxury Hotels in Dubai #DubaiLuxuryHotels #TravelGoals #luxuarystay #visitdubai

  3. [4K] Dubai Travel Vlog 2023

  4. Complete Dubai Travel Guide

  5. 14 Best Places to Visit in Dubai

  6. Tooker Tourism Dubai Tour Packages

COMMENTS

  1. Dubai vacation packages from $673

    Tips for finding Dubai package deals. There are loads of types of vacations in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget ...

  2. Dubai Vacation Packages 2024 from $1,784

    per person. May 8 - May 14. Roundtrip flight included. Newark (EWR) to Dubai (DXB) 9.4/10 Exceptional! (186 reviews) Marina view was beautiful. Reviewed on Mar 20, 2024. Bundle your Dubai flight + hotel & save up to 100% off your flight with Expedia. FREE cancellation on select hotels .

  3. Dubai Vacations 2023 / 2024 l Emirates Vacations

    Book today and enjoy guaranteed savings, low deposits from $199pp, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our dubai vacation offers below or call our destination specialists on 1-855-358-1505 for further details and to book. 30% saving on stay. Book now.

  4. Dubai Vacation Packages 2024 from $1,767

    The Latest Dubai Vacation Packages. 3 nights. 4 nights. 5 nights. 6-7 nights. 5 star. 4 star & up. 3 star & up. 2 star & up. Economy. Premium economy. Business. First class. ... The best Location in downtow Dubai. Reviewed on Apr 3, 2024. Address Dubai Mall. 5 out of 5. Downtown Dubai. Price was $2,601, price is now $1,822 per person. $2,601 ...

  5. Dubai Vacations 2023 / 2024 l Emirates Vacations

    The 40-minute Dubai Silver Air Tour flies you over all the Dubai classics, taking off from either Dubai Creek or Jebel Ali Resort, then cruising along the coastline, giving you a bird's-eye view of The World, Burj Khalifa and Burj Al Arab Jumeirah. Ticket prices from E£ 8,109 per person.

  6. Dubai Vacation Packages & Deals 2024

    In a nutshell: Dubai delivers the ultimate vacation. Make the most of your Dubai getaway with Vacations by Marriott, which offers top-notch hotels across the city, from the stately JW Marriott Marquis Hotel Dubai, to the W Dubai - The Palm, set on a private beach. Dubai Marina, United Arab Emirates.

  7. Dubai Vacation Packages from $1,611

    per person. May 8 - May 15. Roundtrip flight included. Boston (BOS) to Dubai (DXB) Free water park access, 4 restaurants, and 3 outdoor pools are all featured at this all-inclusive hotel. Spend a day at the beach kayaking, or relax with sun loungers and beach umbrellas. There's fun for all ages with a children's pool and a waterslide, and ...

  8. Dubai Vacation Packages from $1,127

    Dubai Vacation Packages Book a Stay + Flight or Car to save on your Vacation Package. Packages; Stays; Flights; Stay added. Flight added. Add a car. 1 room, 2 travelers. Travelers. ... Best time to take a trip to Dubai. Dubai is hot and humid most of the year, but temperatures become a bit more tolerable between October and April. If you love ...

  9. 153 Dubai Tour Packages 2024

    Best Selling Dubai Tour Packages For A Lavish Excursion. 3 Nights/4 Days. ₹27,500/-. Upto 3 Stars, Meals, Sightseeing, Airport Transfer, Entry Tickets, Visa. View Details. Most Reasonable Dubai Packages For A Cherishable Vacation. 4 Nights/5 Days. ₹30,399/-.

  10. Dubai Vacation Packages

    CA $2,287. per person. May 10 - May 19. Roundtrip non-stop flight included. FREE cancellation on select hotels Bundle Dubai flight and hotel to build your own Dubai vacation package & 𝘀𝗮𝘃𝗲 with Expedia! Choose from thousands of Dubai trips & holiday deals.

  11. 64 Dubai Tour Packages 2024: Book Dubai Holiday Packages at the Best Price

    Compare Dubai tours & packages from top Travel agents. 4.6 /5 (137 Reviews) 68 travel agents available for Dubai. Oct 01, 2023: Global Village Dubai is open from 18 October 2023 to 28 April 2024 and Miracle Garden Dubai is open from 29th September 2023 to 30th April 2024. About Dubai Tourism: Known as one of the megacities of the world, Dubai ...

  12. Dubai Vacation Packages with Airfare 2024

    Head 160 stories up to the observation deck of the tallest building in the world for stunning, panoramic views of magnificent Dubai. Dine in style. Sit down to a magical six-course dinner at Al Mahara at the Burj Al Arab Jumeirah, created by a Michelin-starred chef. Tour traditional Dubai.

  13. Dubai vacation packages from C$ 1,132

    Tips for finding Dubai package deals. There are loads of types of vacations in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travellers: Top vacation C$ 670; Family vacation C$ 587; Romantic vacation C$ 830; Luxury vacation C$ 785 ...

  14. 10 Best Dubai Tours & Trips 2024/2025

    Browse the best tours in Dubai with 230 reviews visiting places like Dubai and Abu Dhabi. All Major Brands. ... I had a very good vacation this time with Indus Travel and a good memory for me, I will visit Dubai again Indus Travel next time. Thanks everyone at Indus Travel. Destinations Dubai, Abu Dhabi ... Dubai Luxury Holidays Package 6 Night ...

  15. Dubai Holidays 2023 / 2024

    5 nights from £1,929pp. Half Board. Deluxe Room Ocean with Balcony. Unlimited access to Wild Wadi Waterpark. Travel on selected dates from 24 to 30 October 2024. Return Emirates flights from Manchester. Price based on 2 adults and 2 children.

  16. Dubai All inclusive Vacations 2024

    per person. May 5 - May 8. Roundtrip non-stop flight included. New York (JFK) to Dubai (DXB) 8.8/10 Excellent! (684 reviews) Rixos The Palm Dubai is a luxurious retreat on Palm Jumeirah, blending opulence with top-notch hospitality. The culinary experience is exceptional, with diverse options curated to perfection.

  17. Dubai Vacation Packages & Travel Deals

    Dubai Vacation Packages. Located on the Persian Gulf, Dubai is one of the fastest growing, most culturally diverse and over-the-top cities in the world. Record-breaking architecture — like Burj Khalifa, the world's tallest building — stands alongside traditional neighborhoods, while man-made islands with stunning beaches jut out of the ...

  18. Dubai holiday packages from £344

    Tips for finding cheap holiday packages Dubai. There are loads of types of holidays in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travellers: Top holiday £356; Family holiday £319; Romantic holiday £444; Luxury holiday £414 ...

  19. THE 10 BEST All Inclusive Hotels in Dubai

    All Dubai Hotels Dubai Hotel Deals Last Minute Hotels in Dubai By Hotel Type By Hotel Class By Hotel Brand Popular Amenities Popular Neighborhoods Popular Dubai Categories Near Landmarks Near Train Stations Near ... Searching hundreds of travel sites to find you the best price Clear all filters. Sort by: Best Value. Best Value. Properties ...

  20. Dubai Tour Packages

    Best Dubai Holiday and Travel Packages. We have got a whole bunch of perfect Dubai packages for you Dubai, best known for its architectural delights, also offers the most incredible family-friendly leisure choices, spectacular ever entertainment scene, and charming cultural historical attractions.

  21. 63 Dubai Tour Package Starts @ 𝐑𝐬.59258 𝘽𝙤𝙤𝙠 𝙉𝙤𝙬

    Whether you are looking for Dubai packages for a family or a couple, whether you need escorted Dubai tour packages for your parents or an offbeat Dubai vacation for yourself, MakeMyTrip can help you sort out your Dubai trip plan. MakeMyTrip currently offers over 62 tour packages to Dubai, with prices starting as low as Rs.59258.

  22. 24 Dubai Tour Packages at Exciting Deals Upto 50% Off in 2024

    4 Nights 5 Days. Rs.24 078. Plan your Dubai Tour with Thomas Cook. Why Choose Dubai Tour Packages from Us. Every Dubai holiday package is a curated collection of experiences put together by the travel experts at Thomas Cook India, who are themselves, seasoned travellers, having taken a Dubai holiday many times.

  23. Eid Al Fitr in UAE: 20 best staycation deals across the Emirates

    It's located in Marina, Emirates Hills, Creek Beach and Creek Harbour in Dubai. 20 percent off. Until Apr 7. Vida Beach Resort, Umm Al Quwain; Al Raudah, Umm Al Quwain; Vida Creek Beach; Vida ...