maldives travel requirements emirates

• The Founder
• The Emirates
• The Government
• Passport Strength
• Services for UAE Diplomats
• Services for Individuals
• Services for Businesses
• more services

Quick Links

Travel requirements by destination.

• UAE Missions Abroad
• UAE Events and Conferences

The aim of the travel guide page is to provide instructions and advise for Emirati travelers through an interactive map that showcases all the information they need to know before traveling.

Search results ( country ).

• The Kingdom of the Netherlands
• Peoples Democratic Republic of Algeria
• Republic of Albania
• Republic of Angola
• Republic of Côte dIvoire
• Republic of the Congo
• Socialist Republic of Vietnam
• The Federal Democratic Republic of Ethiopia
• The Hellenic Republic
• The Kingdom of Norway
• The Republic of Colombia
• The Republic of Iraq
• The Republic of Kenya
• The Republic of Korea
• The Republic of Tunisia
• The Republic of Uganda
• The Republic of Yemen
• The Union of the Comoros
• United States of America
• Antigua and Barbuda
• Arab Republic of Egypt
• Argentine Republic
• Bolivarian Republic of Venezuela
• Bosnia and Herzegovina
• Brunei Darussalam
• Burkina Faso
• Central African Republic
• Co operative Republic of Guyana
• Commonwealth of Dominica
• Commonwealth of the Bahamas
• Cook Islands
• Czech Republic
• Democratic Peoples Republic of Korea
• Democratic Republic of Sao Tome and Principe
• Democratic Republic of Timor-Leste
• Democratic Socialist Republic of Sri Lanka
• Dominican Republic
• Federal Republic of Germany
• Federal Republic of Nigeria
• Federated States of Micronesia
• Federation of Saint Kitts and Nevis
• Federative Republic of Brazil
• Fedral Republic of Austria
• French Guiana
• French Republic
• Gabonese Republic
• Grand Duchy of Luxembourg
• Hashemite Kingdom of Jordan
• Hong Kong Special Administrative Region of the Peoples Republic of China
• Independent State of Papua New Guinea
• Independent State of Samoa
• Islamic Republic of Afghanistan
• Islamic Republic of Mauritania
• Islamic Republic of Pakistan
• Italian Republic
• Kingdom of Bahrain
• Kingdom of Belgium
• Kingdom of Bhutan
• Kingdom of Cambodia
• Kingdom of Denmark
• Kingdom of Eswatini
• Kingdom of Lesotho
• Kingdom of Morocco
• Kingdom of Saudi Arabia
• Kingdom of Spain
• Kingdom of Sweden
• Kingdom of Thailand
• Kingdom of Tonga
• Kyrgyz Republic
• Lao Peoples Democratic Republic
• Macao Special Administrative Region of the Peoples Republic of China
• New Zealand
• Oriental Republic of Uruguay
• Peoples Republic of China
• Plurinational State of Bolivia
• Portuguese Republic
• Principality of Andorra
• Principality of Liechtenstein
• Principality of Monaco
• Republic of Armenia
• Republic of Azerbaijan
• Republic of Belarus
• Republic of Benin
• Republic of Botswana
• Republic of Bulgaria
• Republic of Burundi
• Republic of Cabo Verde
• Republic of Cameroon
• Republic of Chad
• Republic of Costa Rica
• Republic of Croatia
• Republic of Cyprus
• Republic of Djibouti
• Republic of Ecuador
• Republic of El Salvador
• Republic of Equatorial Guinea
• Republic of Estonia
• Republic of Fiji
• Republic of Finland
• Republic of Ghana
• Republic of Guatemala
• Republic of Guinea
• Republic of Guinea-Bissau
• Republic of Haiti
• Republic of Honduras
• Republic of Iceland
• Republic of India
• Republic of Kazakhstan
• Republic of Kiribati
• Republic of Kosovo
• Republic of Latvia
• Republic of Lebanon
• Republic of Liberia
• Republic of Lithuania
• Republic of Madagascar
• Republic of Malawi
• Republic of Maldives
• Republic of Mali
• Republic of Malta
• Republic of Mauritius
• Republic of Moldova
• Republic of Mozambique
• Republic of Namibia
• Republic of Nauru
• Republic of Nicaragua
• Republic of Niger
• Republic of North Macedonia
• Republic of Palau
• Republic of Panama
• Republic of Paraguay
• Republic of Peru
• Republic of Poland
• Republic of Rwanda
• Republic of San Marino
• Republic of Senegal
• Republic of Serbia
• Republic of Seychelles
• Republic of Sierra Leone
• Republic of Slovenia
• Republic of South Africa
• Republic of South Sudan
• Republic of Suriname
• Republic of Tajikistan
• Republic of the Gambia
• Republic of the Marshall Islands
• Republic of the Philippines
• Republic of the Sudan
• Republic of Trinidad and Tobago
• Republic of Turkiye
• Republic of Vanuatu
• Republic of Zambia
• Republic of Zimbabwe
• Russian Federation
• Saint Lucia
• Saint Vincent and the Grenadines
• Slovak Republic
• Solomon Islands
• State of Eritrea
• State of Kuwait
• State of Libya
• State of Palestine
• Sultanate of Oman
• Swiss Confederation
• Syrian Arab Republic
• The Commonwealth of Australia
• The Federal Democratic Republic of Nepal
• The Federal Republic of Somalia
• The Islamic Republic of Iran
• The Peoples Republic of Bangladesh
• The Republic of Cuba
• The Republic of Indonesia
• The Republic of Singapore
• The Republic of the Congo
• The Republic of the Union of Myanmar
• The Republic of Uzbekistan
• The State of Israel
• The United Kingdom for Great Britain and Northern Ireland
• Togolese Republic
• Turkmenistan
• United Mexican States
• United Republic of Tanzania

• KAYAK for Business NEW

Maldives Travel Restrictions

Traveller's COVID-19 vaccination status

Travelling from the United Arab Emirates to the Maldives

Open for vaccinated visitors

COVID-19 testing

Not required

Not required for vaccinated visitors

Restaurants

Not required in enclosed environments and public transportation.

Documents & Additional resources

Ready to travel, find flights to the maldives, find stays in the maldives, explore more countries on travel restrictions map, destinations you can travel to now, dominican republic, philippines, saudi arabia, the bahamas, united kingdom, united states, know when to go.

Sign up for email alerts as countries begin to open - choose the destinations you're interested in so you're in the know.

Can I travel to the Maldives from the United Arab Emirates?

Most visitors from the United Arab Emirates, regardless of vaccination status, can enter the Maldives.

Can I travel to the Maldives if I am vaccinated?

Fully vaccinated visitors from the United Arab Emirates can enter the Maldives without restrictions.

Can I travel to the Maldives without being vaccinated?

Unvaccinated visitors from the United Arab Emirates can enter the Maldives without restrictions.

Do I need a COVID test to enter the Maldives?

Visitors from the United Arab Emirates are not required to present a negative COVID-19 PCR test or antigen result upon entering the Maldives.

Can I travel to the Maldives without quarantine?

Travellers from the United Arab Emirates are not required to quarantine.

Do I need to wear a mask in the Maldives?

Mask usage in the Maldives is not required in enclosed environments and public transportation.

Are the restaurants and bars open in the Maldives?

Restaurants in the Maldives are open. Bars in the Maldives are .

• KAYAK for Business NEW

Maldives Travel Restrictions

Traveler's COVID-19 vaccination status

Traveling from the United States to the Maldives

Open for vaccinated visitors

COVID-19 testing

Not required

Not required for vaccinated visitors

Restaurants

Not required in enclosed environments and public transportation.

Maldives entry details and exceptions

Documents & additional resources, ready to travel, find flights to the maldives, find stays in the maldives, explore more countries on travel restrictions map, destinations you can travel to now, dominican republic, netherlands, philippines, puerto rico, switzerland, united arab emirates, united kingdom, know when to go.

Sign up for email alerts as countries begin to open - choose the destinations you're interested in so you're in the know.

Can I travel to the Maldives from the United States?

Most visitors from the United States, regardless of vaccination status, can enter the Maldives.

Can I travel to the Maldives if I am vaccinated?

Fully vaccinated visitors from the United States can enter the Maldives without restrictions.

Can I travel to the Maldives without being vaccinated?

Unvaccinated visitors from the United States can enter the Maldives without restrictions.

Do I need a COVID test to enter the Maldives?

Visitors from the United States are not required to present a negative COVID-19 PCR test or antigen result upon entering the Maldives.

Can I travel to the Maldives without quarantine?

Travelers from the United States are not required to quarantine.

Do I need to wear a mask in the Maldives?

Mask usage in the Maldives is not required in enclosed environments and public transportation.

Are the restaurants and bars open in the Maldives?

Restaurants in the Maldives are open. Bars in the Maldives are .

• Area Guides
• Building Guides
• School Guides
• Floor plans
• Market Trends
• Life at Bayut

Travelling from UAE to Maldives – A Complete Guide

Major attractions, visa information, currency and costs, flight booking, accommodation, getting around.

Maldives lures tourists from all over the world. With exotic islands, sparkling beaches, unmatched luxury and a variety of activities, this gorgeous destination is particularly popular residents of the UAE. Planning a holiday there? We’ve got all the information you need to travel from the UAE to Maldives.

Maldives is an island nation located in South Asia that has garnered a reputation for being a tourist hotspot. It’s currently one of the most popular destinations for those travelling from the UAE since it offers visas on arrival for the residents.

With turquoise waters, white sandy beaches, waterside villas and untouched nature, Maldives is known for its tropical charm and balmy coastal temperatures.

There is plenty to do on the island. You can go deep diving to watch the manta rays and sea turtles or enjoy a performance of the traditional Boduberu (a popular folk dance). Also, make sure to visit Vaadhoo Island in Raa Atoll. Often called the Sea of Stars, Vadhoo has an abundance of plankton that shimmer in the night, being swept onshore at the mercy of the tides, making the surrounding waters appear like they are filled with stars.

The first thing you need to consider when planning a trip from the UAE to Maldives is the visa requirements. Fortunately, travellers from the UAE don’t need a pre-approval of the visa as Maldives issues a 30-day visa on arrival to all nationalities.

To receive a visa upon arrival in the Maldives, you need to provide the following documents.

• A passport or travel document that is valid for at least one month .
• Sufficient funds for covering the cost of the stay in the Maldives. You can either show a confirmation of reservation in a Tourist Resort or a Hotel or USD 100 + USD 50 for each day of your stay.
• A valid ticket for your journey out of Maldives within the stipulated time frame.

The Rufiyaa is the currency used in the Maldives.

The travelling cost varies depending on the season, length of stay and type of accommodation. Staying in hotels and resorts can be expensive as it is a luxurious location. Guesthouses are a great alternative for those looking for budget-friendly lodging. The hotel stay can cost anything from AED 100 to AED 6,000.

The airfare also varies depending on the time of the year. You can also choose budget-friendly flight options . If you are flying with Emirates, the one-way ticket from Dubai and Male will cost you AED 2,120 onwards, while the flights via FlyDubai start from AED 2,750.

The airlines offering direct and non-direct flights to the Maldives include Emirates Airlines, flydubai, Qatar Airways, SpiceJet and IndiGo. You can take a flight from the Dubai International Airport to Gan Airport in Gan Island or the Velana International Airport in Male. The flight duration from Dubai to Male is 4 hours and 10 minutes.

Some of the luxury hotels in the Maldives are:

• Four Seasons Resort Maldives at Landaa Giraavaru
• Waldorf Astoria Maldives Ithaafushi
• Anantara Veli Maldives Resort
• Intercontinental Maldives Maamunagau Resort
• The St. Regis Maldives Vommuli Resort
• Hard Rock Hotel Maldives
• Fairmont Maldives

There are many budget-friendly accommodation options in the Maldives. These include Ameera Maldives, Lagoon Villa Thoddoo, Crown Beach Hotel, TME Retreats Dhigurah and Liberty Guest House.

Depending on your mode of transportation and your location, the cost of transportation when visiting the Maldives can change. Here are three examples of available forms of transportation:

• Domestic flight: A domestic flight may be required if you’re moving between islands in the Maldives.
• Speedboat: Many hotels, resorts, and inns provide speedboat transportation from the airport to their locations.
• Public ferry – If you’re on a tight budget, you can take a public ferry between some of the Maldives’ islands. Although the price is typically lower, the journey duration may be longer and the schedules may be less frequent.

HOW LONG IS THE FLIGHT FROM UAE TO MALDIVES? 

The minimum flight time from UAE to the Maldives is 4 hours and 10 minutes.

IS MALDIVES AN EXPENSIVE DESTINATION?

Yes, the Maldives is considered to be an expensive option due to greater lodging costs and traveller taxes. However, during the wet season, from May to November, prices do drop significantly.

And this concludes our guide to travelling from the UAE to Maldives. Note that the island is one of the destinations UAE residents can visit without a visa . So what are you waiting for? Plan a Maldives trip from the UAE this summer!!!

If you want to travel to a destination a little close to your city, a  trip from Dubai to Salala  is a fantastic option.

Leave a Reply Cancel Reply

Hotel Guide – Fairmont Dubai: Enjoy 5-star luxury

Curtains up! All about Theatre by Erth and its upcoming shows

Ramhan Island Abu Dhabi – the luxurious waterfront community

• Residential Plot

Sliding Sidebar

Situation in Haiti April 13, 2024

U.s. citizens in haiti, update april 12, 2024, information for u.s. citizens in the middle east.

• Travel Advisories |
• Contact Us |
• MyTravelGov |

Find U.S. Embassies & Consulates

Travel.state.gov, congressional liaison, special issuance agency, u.s. passports, international travel, intercountry adoption, international parental child abduction, records and authentications, popular links, travel advisories, mytravelgov, stay connected, legal resources, legal information, info for u.s. law enforcement, replace or certify documents.

Before You Go

Learn About Your Destination

While Abroad

Emergencies

Share this page:

Travel Advisory June 23, 2023

Maldives - level 2: exercise increased caution.

Reissued with updates to health information.

Exercise increased caution in Maldives due to terrorism .

Country Summary: Terrorist groups may conduct attacks with little or no warning, targeting tourist locations, transportation hubs, markets/shopping malls, and local government facilities. Attacks may occur on remote islands which could lengthen the response time of authorities.   

If you decide to travel to Maldives:

• Visit the CDC page for the latest Travel Health Information related to your travel.
• Avoid demonstrations and crowds.
• Monitor local media for breaking events and be prepared to adjust your plans.
• Be aware of your surroundings.
• Stay alert in locations frequented by Westerners.
• Enroll in the Smart Traveler Enrollment Program ( STEP ) to receive Alerts and make it easier to locate you in an emergency.
• Follow the Department of State on Facebook and Twitter .
• Review the Country Security Report for Maldives.
• Prepare a contingency plan for emergency situations. Review the Traveler’s Checklist  plan for emergency situations.

Embassy Messages

View Alerts and Messages Archive

Quick Facts

Must be valid Must be valid for six months from expected date of departure from Maldives.

One page required for entry stamp

Visitor visa available at the airport for stays up to 30 days

Required for entry if arriving from or transmitting through a yellow fever endemic country (see below)

Embassies and Consulates

U.s. embassy colombo.

210 Galle Road, Colombo 03, Sri Lanka Telephone: +(94) (11) 202-8500 Fax: +(94) (11) 202-8590 [email protected] U.S. Embassy Maldives

Destination Description

See the Department of State’s Fact Sheet on Maldives for information on U.S.-Maldives relations.

Entry, Exit and Visa Requirements

A valid passport, along with an onward/return ticket and sufficient funds, is required for entry. A no-cost visitor visa valid for 30 days is issued upon arrival. A Traveler Health Declaration (THD) must be filled in and submitted by all travelers travelling to and from Maldives, within 96 hours prior to their travel. You may submit the form electronically .

The  Department of Immigration and Emigration  routinely approves requests for extension of stays up to 90 days for travelers who present evidence of sufficient funds and who stay in a resort/hotel or present a letter from a local sponsor. Anyone staying more than 60 days without proper authorization faces heavy fines and deportation.

Yellow fever vaccine is required for individuals above nine months of age who are traveling to Sri Lanka from a country designated by the World Health Organization (WHO) to have a risk of yellow fever transmission, including transit wait time of more than 12 hours in an airport located in such a country. For more information, please refer to WHO .

Visit the Republic of Maldives, Department of Immigration and Emigration for the most current visa information.

The U.S. Department of State is unaware of any HIV/AIDS entry restrictions for visitors to or foreign residents of Maldives.

Find Information on  dual nationality , prevention of international child abduction and  customs regulations on our websites.

Safety and Security

Terrorism: Terrorist groups and those inspired by such organizations are intent on attacking U.S. citizens abroad. Terrorists are increasingly using less sophisticated methods of attack – including knives, firearms, and vehicles – to more effectively target crowds. Frequently, their aim is unprotected or vulnerable targets, such as:

• High-profile public events (sporting contests, political rallies, demonstrations, holiday events, celebratory gatherings, etc.)
• Hotels, clubs, and restaurants frequented by tourists
• Places of worship
• Public transportation systems (including subways, buses, trains, and scheduled commercial flights)

For more information, see our Terrorism page.

Crime: Maldives has a low crime rate and crime on resort islands is rare. Valuables may be stolen when left unattended on beaches or in hotels. The penalty for drug use or possession is severe.

Demonstrations  may take place in response to political or economic issues, but primarily take place in Malé or other larger cities and are unlikely to be noticed by tourists.

• Demonstrations can be unpredictable, avoid areas around protests and demonstrations. 
• Check local media for updates and traffic advisories.

  International Financial Scams:  See the Department of State and FBI pages for information.

Technology Usage Abroad: Mobiles devices are vulnerable to compromise, theft, and physical damage anywhere in the world. Best practices prior to traveling abroad are keeping all software (operating system and apps) updated, and use virtual private network and encrypted voice over IP (VoIP) applications if possible. Make sure that all VPN/VoIP are reputable, and U.S. based. Do not connect to unknown open Wi-Fi.

GPS Navigation Apps are helpful in getting U.S. citizens around in a foreign country. Prior to using the GPS app make sure you research the route to make sure it is safe. GPS navigation apps may give you the shortest route without safety consideration.

Be cautious of using dating apps/online dating websites abroad as U.S. citizens can be targeted by scammers. Make sure to inform your friends and family of your whereabouts, meet at a well-known public location, and do not consume suspicious food or drinks. Avoid traveling alone to bars or nightclubs.

Victims of Crime: U.S. citizen victims of sexual assault are encouraged to contact the U.S. Embassy in Colombo for assistance.

Report crimes to the local police at 119 and contact the U.S. Embassy in Colombo at +94-11-202-8500. Remember that local authorities are responsible for investigating and prosecuting crime.

See our webpage on help for U.S. victims of crime overseas .

• Help you find appropriate medical care ;
• Assist you in reporting a crime to the police;
• Contact relatives or friends with your written consent;
• Provide general information regarding the victim’s role during the local investigation and following its conclusion;
• Provide a list of local attorneys;
• Provide our information on victim’s compensation programs in the U.S. ;
• Provide an emergency loan for repatriation to the United States and/or limited medical support in cases of destitution;
• Help you find accommodation and arrange flights home; and
• Replace a stolen or lost passport .

Domestic Violence: U.S. citizen victims of domestic violence are encouraged to contact the Embassy for assistance.

Tourism: The tourism industry is unevenly regulated, and safety inspections for equipment and facilities do not commonly occur at all tourist facilities. Hazardous areas/activities are not always identified with appropriate signage, and staff may not be trained or certified either by the host government or by recognized authorities in the field. In the event of an injury, appropriate medical treatment is typically available only in/near major cities. First responders are generally unable to access areas outside of major cities and to provide urgent medical treatment. U.S. citizens are encouraged to purchase medical evacuation insurance. See our webpage for more information on insurance providers for overseas coverage .

Local Laws & Special Circumstances

Criminal Penalties: You are subject to local laws. If you violate local laws, even unknowingly, you may be expelled, arrested, or imprisoned. Individuals establishing a business or practicing a profession that requires additional permits or licensing should seek information from the competent local authorities, prior to practicing or operating a business.

When transiting Maldives, travelers should ensure their luggage does not contain prohibited or restricted items, which include weapons, ammunition, alcohol, pornography, and religious material offensive to Islam, among other items. In some places, it is illegal to take pictures of certain buildings.

Religious Laws : Public observance of any religion other than Islam is prohibited. Religious gatherings such as Bible study groups are prohibited; however, a family unit may practice its religion, including Bible readings, within its residence. It is against the law to invite or encourage Maldivian citizens to attend these gatherings. Offenders may face jail sentences, expulsion, and/or fines. Although Maldivian law prohibits importing “idols for religious worship,” tourists traveling to the resort islands are generally allowed to bring in items and texts used for personal religious observances.

Furthermore, some laws are also prosecutable in the United States, regardless of local law. For examples, see our website on crimes against minors abroad and the Department of Justice website.

Arrest Notification: If you are arrested or detained, ask police or prison officials to notify the U.S. Embassy immediately. See our webpage for further information.

Students:  See our  Students Abroad  page and  FBI travel tips .

LGBTQI+ Travelers:   The law prohibits same-sex sexual conduct. Under the penal code, the punishment for conviction includes up to eight years’ imprisonment and 100 lashes. None of the legal provisions prohibiting discrimination covers discrimination based on sexual orientation or gender identity and the law does not recognize LGBTQI+ individuals, couples, and their families. See our  LGBTQI+ Travel Information page and section 6 of our Human Rights report  for further details.

Travelers with Disabilities: While in Maldives, individuals with disabilities may find accessibility and accommodation very different from what you find in the United States. The Maldivian constitution provides for the rights and freedom from discrimination of persons with disabilities, and parliament passed a Disability Act in 2010. The new law requires public places such as supermarkets and parks to have facilities that will enable access for people with disabilities. Despite the law, most public places do not yet have access for the disabled, and implementation of the law may take some time.

Travelers: If you find yourself in a life-threatening situation, you should call the police immediately and follow up with a call to the U.S. Embassy in Colombo (+94-11-202-8500). We can sometimes connect you with a non-governmental organization in the Maldives that may be able to provide assistance. 

If you are victimized overseas, you may be entitled to receive compensation for counseling and/or other services such as relocation back to the United States. For further information, visit the U.S. Department of Justice's Office on Violence Against Women .

Remember that local authorities are responsible for investigating and prosecuting crime committed in the Maldives.

See our tips for  Women Travelers . 

For Ambulance services in the Maldives, dial 102.

Ambulance services are not present throughout the country or are unreliable in most areas except Malé/Hulhumalé. Available ambulances are not staffed with trained paramedics and often have little or no medical equipment. Some inter-island sea ambulance service is available via the Maldivian Navy but does not serve the entire country.

We highly recommend that all travelers review the U.S. Centers for Disease Control and Prevention’s Travelers’ Health webpage and general Traveler Advice for Maldives.

• Review all sub-sections including the Travel Health Notices, Vaccines and Medicines, Non-Vaccine-Preventable Diseases, Stay Healthy and Safe, Healthy Travel Packing List, and After Your Trip.
• Reasons for Travel (for example: Adventure Travel, Spring Break Travel)
• Travelers with Special Considerations (for example: Allergies, Long-Term Travelers and Expatriates)
• and General Tips (for example: Traveling with Medications, Travel Vaccines)

The Department of State, U.S. embassies and U.S. consulates do not pay medical bills. Be aware that U.S. Medicare/Medicaid does not apply overseas. Most hospitals and doctors overseas do not accept U.S. health insurance.

Medical Insurance: Make sure your health insurance plan provides coverage overseas. Most care providers overseas only accept cash payments. See our webpage for more information on insurance providers for overseas coverage. Visit the U.S. Centers for Disease Control and Prevention for more information on type of insurance you should consider before you travel overseas.

The Department of State strongly recommends supplemental insurance to cover medical evacuation.

Medical Facilities: There are three large hospitals in the Malé area: ADK Hospital, Tree Top Hospital, and the government-run IGMH. Medical facilities outside Malé are limited. Hospitals and doctors typically require payment “up front” prior to service or admission. The availability of medical supplies is uneven and many common medications used in the United States are not available in Maldives; therefore, travelers should always carry any prescription medications with them.

The U.S. Embassy maintains a list of doctors and hospitals . We do not endorse or recommend any specific medical provider or clinic.

Vaccinations: Be up-to-date on all vaccinations recommended by the U.S. Center for Disease Control and Prevention (CDC). Recommended vaccines that are specific to this region include Japanese encephalitis and typhoid (and rabies pre-exposure prophylaxis only if exposure to bats is anticipated).

Pharmaceuticals : Exercise caution when purchasing medication overseas. Pharmaceuticals, both over the counter and requiring prescription in the United States, are often readily available for purchase with little controls. Counterfeit medication is common and may prove to be ineffective, the wrong strength, or contain dangerous ingredients. Medication should be purchased in consultation with a medical professional and from reputable establishments. Please visit U.S. Centers for Disease Control and Prevention website for more information.

Always carry your prescription medication in original packaging, along with your doctor’s prescription. Check with the Maldives Ministry of Health to ensure the medication is legal in Maldives.

Air Quality: Visit AirNow Department of State for information on air quality at U.S. Embassy and Consulates.

Water Quality : You should use ONLY boiled or bottled water for drinking, making ice, and for beverages.

Further health information:

• World Health Organization
• U.S. Centers for Disease Control and Prevention (CDC)

Travel and Transportation

Traffic Safety, Road and Aviation Conditions: While in Maldives, you may encounter road conditions that differ significantly from those in the United States. The information below concerning Maldives is provided for general reference only and may vary by location or circumstance. 

Only a few of the islands are large enough to support automobiles. Maldives has good safety standards for land, sea and air travel. Roads in Malé and on the airport island are brick and generally well-maintained, though congested. Dirt roads on resort islands are well-kept by the resorts. Transportation in Malé is either by foot, by bus, or by readily-available taxis that charge a fixed fee for any single journey. Transportation between the airport and Malé is by vehicle or by a public ferry. Travel to nearby resort islands is usually by motorized water taxi and speedboat or seaplane. Trans Maldivian and Maldivian Air Taxi provide charter seaplane service to outlying islands during daylight hours. Maldivian, Manta Air, and Villa Air run fixed-wing domestic service to some of the atolls with land runways during night hours as well. Many resorts stop boat transfers between the airport and the resort island after sunset. Visitors to distant resorts arriving in the country at night can expect to stay overnight at a hotel in Malé or at the airport hotel and should confirm transfer arrangements in advance. 

See our  Road Safety  page for more information. Visit the website of the Official Travel Guide of Maldives and national authority responsible for road safety.

Aviation Safety Oversight:  As there is no direct commercial air service to the United States by carriers registered in Maldives, the U.S. Federal Aviation Administration (FAA) has not assessed the government of Maldives’ Civil Aviation Authority for compliance with International Civil Aviation Organization (ICAO) aviation safety standards. Further information may be found on the FAA's safety assessment page .

Maritime Travel: Mariners planning travel to the Republic of Maldives should also check for U.S. maritime advisories and alerts . Information may also be posted to the U.S. Coast Guard homeport website , and the NGA broadcast warnings .

For additional travel information

• Enroll in the  Smart Traveler Enrollment Program (STEP)  to receive security messages and make it easier to locate you in an emergency.
• Call us in Washington, D.C. at 1-888-407-4747 (toll-free in the United States and Canada) or 1-202-501-4444 (from all other countries) from 8:00 a.m. to 8:00 p.m., Eastern Standard Time, Monday through Friday (except U.S. federal holidays).
• See the  State Department’s travel website  for the  Worldwide Caution  and  Travel Advisories .
• Follow us on  Twitter  and  Facebook .
• See  traveling safely abroad  for useful travel tips.

For additional IPCA-related information, please see the  International Child Abduction Prevention and Return Act ( ICAPRA )  report.

Travel Advisory Levels

Assistance for u.s. citizens, maldives map, learn about your destination, enroll in step.

Subscribe to get up-to-date safety and security information and help us reach you in an emergency abroad.

Recommended Web Browsers: Microsoft Edge or Google Chrome.

Check passport expiration dates carefully for all travelers! Children’s passports are issued for 5 years, adult passports for 10 years.

Afghanistan

Antigua and Barbuda

Bonaire, Sint Eustatius, and Saba

Bosnia and Herzegovina

British Virgin Islands

Burkina Faso

Burma (Myanmar)

Cayman Islands

Central African Republic

Cote d Ivoire

Curaçao

Czech Republic

Democratic Republic of the Congo

Dominican Republic

El Salvador

Equatorial Guinea

Eswatini (Swaziland)

Falkland Islands

France (includes Monaco)

French Guiana

French Polynesia

French West Indies

Guadeloupe, Martinique, Saint Martin, and Saint Barthélemy (French West Indies)

Guinea-Bissau

Isle of Man

Israel, The West Bank and Gaza

Liechtenstein

Marshall Islands

Netherlands

New Caledonia

New Zealand

North Korea (Democratic People's Republic of Korea)

Papua New Guinea

Philippines

Republic of North Macedonia

Republic of the Congo

Saint Kitts and Nevis

Saint Lucia

Saint Vincent and the Grenadines

Sao Tome and Principe

Saudi Arabia

Sierra Leone

Sint Maarten

Solomon Islands

South Africa

South Korea

South Sudan

Switzerland

The Bahamas

Timor-Leste

Trinidad and Tobago

Turkmenistan

Turks and Caicos Islands

United Arab Emirates

United Kingdom

Vatican City (Holy See)

External Link

You are about to leave travel.state.gov for an external website that is not maintained by the U.S. Department of State.

Links to external websites are provided as a convenience and should not be construed as an endorsement by the U.S. Department of State of the views or products contained therein. If you wish to remain on travel.state.gov, click the "cancel" message.

You are about to visit:

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• All Inclusive Offers
• Athens Vacations
• Early bird offers
• Dubai Vacations
• Last Minute Escapes

Maldives Vacations

• Milan Vacations
• Upgrades & More

Featured Destinations

Middle east.

• Ras Al Khaimah

Indian Ocean

• Philippines
• South Korea
• South Africa
• All-Inclusive Vacations
• Beach Vacations
• Business Class Vacations
• Family Vacations
• Ultimate Luxury
• Wellness Vacations
• Egypt - Splendours of the Nile
• India - Golden Triangle Tour
• Italy - Milan and Lake Como
• Jordan - Jordan Explorer Tour
• South East Asia
• Sri Lanka - Serendib Explorer
• COVID-19 Hub
• Pay My Balance
• 1-855-358-1505
• Flight + Hotel

Search Holidays

• Manage My Booking

Maldives Offers

Maldives beach & water villas, maldives watersports & on land activities, maldives all inclusive.

The Maldives is a byword for luxury living, beachside bliss and storybook surroundings. Sprinkled across some 200 inhabited islands, each providing a home to whiter-than-white sands and clear, lukewarm lagoons, which assume a surreal shade of blue-green found only in the Maldives. Perfect for each and every type of escape, be it a last minute vacation , a short beach break , or a romantic getaway - this is arguably the best honeymoon destination in the world, after all.

If you’d like to see what other amazing vacations we have available, you can see our full range of Maldives vacations here . Book today and enjoy guaranteed savings , low deposits from $199pp, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our special offers below or call our destination specialists on 1-855-358-1505 for more information and to book your dream Maldives Vacation .

25% savings on stay

Kuredu island resort, maldives.

• 7 nights from $2,139pp
• Garden Bungalow
• Breakfast, lunch and dinner included
• Early booking 25% savings on stay
• Additional benefits for honeymooners
• Additional Skywards Miles
• All taxes and surcharges included
• Round-trip economy class flights with Emirates from New York (JFK)

Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.

• 20% savings on stay

Meeru Island Resort, Maldives

• 7 nights from $2,409pp
• Garden Room

11% savings on stay

Kandima maldives.

• 7 nights from $2,509pp
• Breakfast included
• Complimentary stay for kids
• Early booking 11% savings on stay

• 15% savings on stay

Riu Atoll Maldives

• 7 nights from $2,639pp
• Standard Room
• All-inclusive
• Additional benefits for Honeymooners

• 30% savings on stay

LUX* South Ari Atoll

• 7 nights from $3,165pp
• Beach Pavilion
• Reduced seaplane transfer rates

45% savings on stay

Ja manafaru, maldives.

• 7 nights from $4,045pp
• Beach Villa with Private Pool
• All-Inclusive
• Early booking 45% savings on stay

Imagine waking up, stepping outside your villa and straight away feeling the sensation of soft white sand between your toes. Followed by a short stroll to the warm, crystal clear waters of the Indian Ocean. Or alternatively, don’t leave your villa at all and simply soak up the early morning sun from the comfort of your own private deck. All of which are possibilities in a majority of enchanting Maldives Resorts, when staying in a beach villa .

On the other hand, envisage the sensation of falling asleep to the soothing sounds of a gently lapping lagoon. Before waking up entirely surrounded by a surreal, aquamarine expanse of Indian Ocean - lulling you in for an early morning swim, as you step directly from your water villa into the warm water that beckons below your feet. Complete in a majority of water villas with prime positions on the west coast of your island, revealing unrivalled views as the sun slowly makes its descent into the depths of Indian Ocean.

Some resorts, meanwhile, take villas to a whole new level, which come no more amazing than in the glass-floored villas that are readily available in a selection of hotels. The Maldives may just be one of a handful of locations around the world where you can relax in your luxury lounge, whilst admiring the colorful marine life that swims beneath your feet.

Soneva Jani

Four Seasons Kuda Huraa

Anantara Veli Resort and Spa

Niyama Private Islands

The Maldives is a veritable water wonderland, with many of the islands home to a personal stretch of clear, blue ocean. Making vacations here among the best in the world for some underwater (or overwater) exploration, as you scuba dive, snorkel, swim or sail your way around this charming archipelago.

As such, scuba diving should top any water-based itinerary, with many resorts housing their own PADI Dive Centers. Catering for all ages and levels of expertise, where you’ll be educated in the ways of the water before diving deep below the ocean’s surface in search of sea turtles, stingrays and the world’s largest fish: the gentle whale shark. Alternatively, take to the waters for some less intense snorkeling and explore the colorful coral reefs that provide a home to schools of tropical fish, turtles, reef sharks and octopus.

Adrenaline-fueled activities are also widespread in the Maldives. As you ride the waves with watersports spanning: wakeboarding, jet skiing, surfing, windsurfing, kayaking and even glass-bottom kayaking - or soar above the reefs and water below during a spot of parasailing. Less strenuous water-based activities can also see you setting off on a selection of boat tours , ranging from sunset cruises aboard a traditional dhoni, to glass-bottom boat excursions and voyages that will take you to some of the best locations to spot dolphins in the Maldives.

Back on land, all resorts are home to state-of-the-art sports facilities , with tennis, golf, volleyball, football and cycling widespread. Complemented, of course, by world-famous spas where you can look forward to no end of revitalizing treatments, which are assured to have you looking and feeling like a million dollars (or 1,5407,489 Maldivian Rufiyaa).

Hard Rock Hotel Maldives

Vilamendhoo Island Resort Hotel

You & Me Maldives Resort

Meeru Island Resort

Take the stress out of your vacation with an all-inclusive stay in the Maldives. As many resorts offer the option to have all your meals, drinks and snacks provided from the moment you check-in, right up until you check-out - allowing you to focus on the all-important task of enjoying yourself.

But don’t think for a second that because all your meals have already been paid for that the quality of dining will drop. The Maldives is renowned around the world for its exceptional culinary offerings, with resorts providing a home to globe-conquering chefs and using only the freshest ingredients - of which seafood takes center stage, which is unsurprising given the nation’s affinity to the water. Fresh fruit and in particular coconuts also feature heavily in the country’s traditional dishes, but you can be rest assured that even the fussiest of eaters will be provided for with hotels housing a global array of restaurants, each catering to any specific dietary requirements you may have.

The nation’s locales also reveal some of the world’s most magical settings to enjoy breakfast, lunch or dinner. Ranging from opportunities to dine upon a remote, uninhabited island, or to savor an evening meal from the beach, or on a boat, as the sun sets over these endlessly enchanting islands. Making for meals to remember on an all-inclusive stay in the Maldives.

Anantara Dhigu Maldives

Constance Moofushi Resort

Centara Ras Fushi Resort & Spa Maldives

LUX* South Ari Atoll, Maldives

Join the emirates vacations community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Vacations?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

• KAYAK for Business NEW

Maldives Travel Restrictions

Traveller's COVID-19 vaccination status

Travelling from South Africa to the Maldives

Open for vaccinated visitors

COVID-19 testing

Not required

Not required for vaccinated visitors

Restaurants

Not required in enclosed environments and public transportation.

Documents & Additional resources

Ready to travel, find flights to the maldives, find stays in the maldives, explore more countries on travel restrictions map, destinations you can travel to now, dominican republic, new zealand, philippines, united arab emirates, united kingdom, united states, know when to go.

Sign up for email alerts as countries begin to open - choose the destinations you're interested in so you're in the know.

Can I travel to the Maldives from South Africa?

Most visitors from South Africa, regardless of vaccination status, can enter the Maldives.

Can I travel to the Maldives if I am vaccinated?

Fully vaccinated visitors from South Africa can enter the Maldives without restrictions.

Can I travel to the Maldives without being vaccinated?

Unvaccinated visitors from South Africa can enter the Maldives without restrictions.

Do I need a COVID test to enter the Maldives?

Visitors from South Africa are not required to present a negative COVID-19 PCR test or antigen result upon entering the Maldives.

Can I travel to the Maldives without quarantine?

Travellers from South Africa are not required to quarantine.

Do I need to wear a mask in the Maldives?

Mask usage in the Maldives is not required in enclosed environments and public transportation.

Are the restaurants and bars open in the Maldives?

Restaurants in the Maldives are open. Bars in the Maldives are .

Cookies on GOV.UK

We use some essential cookies to make this website work.

We’d like to set additional cookies to understand how you use GOV.UK, remember your settings and improve government services.

We also use cookies set by other sites to help us deliver content from their services.

You have accepted additional cookies. You can change your cookie settings at any time.

You have rejected additional cookies. You can change your cookie settings at any time.

• Passports, travel and living abroad
• Travel abroad
• Foreign travel advice

Entry requirements

This advice reflects the UK government’s understanding of current rules for people travelling on a full ‘British citizen’ passport from the UK, for the most common types of travel.

The authorities in Maldives set and enforce entry rules. If you’re not sure how these requirements apply to you, contact the Maldivian High Commission in the UK .

All travellers to Maldives must complete a Traveller Declaration Form (IMUGA) within 96 hours of arrival and departure.

COVID-19 rules

There are no COVID-19 testing or vaccination requirements for travellers entering Maldives.

Passport validity requirements

Your passport must have an ‘expiry date’ at least one month after the date you arrive in Maldives. Make sure your passport is not damaged or you may be stopped by immigration. 

Check with your travel provider that your passport and other travel documents meet requirements. Renew your passport if you need to.

You will be denied entry if you do not have a valid travel document or try to use a passport that has been reported lost or stolen.

Visa requirements

You will get a 30-day visa on arrival if you enter Maldives as a tourist.

If you intend to work in Maldives, you must get a work visa before you travel .

For further information on entry requirements and visas, contact the Maldives immigration department .

Vaccination requirements

At least 8 weeks before your trip, check the vaccinations and certificates you need in TravelHealthPro’s Maldives guide.    

Depending on your circumstances, these may include a yellow fever certificate.

Customs rules

There are strict rules about goods you can take into or out of Maldives . You must declare anything that may be prohibited or subject to tax or duty.  

It is illegal to bring in anything deemed contrary to Islam, including ‘idols for worship’, bibles, pork and pork products, and alcohol.

Related content

Is this page useful.

• Yes this page is useful
• No this page is not useful

Help us improve GOV.UK

Don’t include personal or financial information like your National Insurance number or credit card details.

To help us improve GOV.UK, we’d like to know more about your visit today. We’ll send you a link to a feedback form. It will take only 2 minutes to fill in. Don’t worry we won’t send you spam or share your email address with anyone.

TRAVEL SUPPORT

• Travel requirements for Dubai

Travel advice for Dubai residents

Find out the process for returning to Dubai, whether you’re already overseas or you plan to fly from Dubai and return. 

Tourists travelling to, from, and through Dubai

Follow the process to make sure you have everything you need before you travel to, from, or connect through Dubai.

• COVID-19 information hub